SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019095 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019095
Domain Number 1 Region: 73-213
Classification Level Classification E-value
Superfamily Cadherin-like 7.46e-31
Family Cadherin 0.00000623
Further Details:      
 
Domain Number 2 Region: 304-431
Classification Level Classification E-value
Superfamily Cadherin-like 1.96e-26
Family Cadherin 0.00076
Further Details:      
 
Domain Number 3 Region: 193-308
Classification Level Classification E-value
Superfamily Cadherin-like 5.37e-20
Family Cadherin 0.00028
Further Details:      
 
Domain Number 4 Region: 6-85
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000371
Family Cadherin 0.00041
Further Details:      
 
Domain Number 5 Region: 417-519
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000186
Family Cadherin 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019095   Gene: ENSNLEG00000015745   Transcript: ENSNLET00000020060
Sequence length 724
Comment pep:known_by_projection supercontig:Nleu1.0:GL397551.1:21595:114073:1 gene:ENSNLEG00000015745 transcript:ENSNLET00000020060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IRSDKDNDIPIRYSITGVGADQPPMEVFSIDSMSGRMYVTRPMDREEHASYHLRAHAVDM
NGNKVENPIDLYIYVIDMNDNRPEFINQVYNGSVDEGSKPGTYVMTVTANDADDSTTANG
MVRYRIVTQTPQSPSQNMFTINSETGDIVTVAAGLDREKVQQYTVIIQATDMEGNLNYGL
SNTATAIITVTDVNDNPPEFTTSTFAGEVPENRVETVVANLTVMDRDQPHSPNWNAVYRI
ISGDPSGHFSVRTDPVTNEGMVTVVKAVDYEFNRAFLLTVMVSNQAPLASGIQMSFQSTA
GVTISVMDINEAPYFPSNHKLIRLEEGVPPGTVLTTFSAVDPDRFVQQAVRYSKLSDPAN
WLHINTTNGQITTAAVLDRESLYTKNNVYEATFLAADNGIPPASGTGTLQIYLIDINDNA
PELLPKEAQICEKPNLNAINITAADADIDPNIGPYVFELPFVPAAVRKNWTITRLNGDYA
QLSLRILYLEAGMYDVPIIVTDSGNPPLSNTSIIKVKVAPRSDPFTCKSINDVSKLSWGD
GLSQPVRTSVCIYTPMVLLFVVWMKRREKERHTKQLLIDPEDDVRDNILKYDEEGGGEED
QDYDLSQMQQPEAMGHVPSKAPGVRRVDERPVGAEPQYPIRPMVPHPGDIGDFINEGLRA
ADNDPTAPPYDSLLVFDYEGNGSTAGSVSSLNSSSSGDQDYDYLNDWGPRFKKLADMYGG
SEED
Download sequence
Identical sequences ENSNLEP00000019095 ENSNLEP00000019095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]