SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019096 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019096
Domain Number 1 Region: 148-446
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.63e-80
Family Eukaryotic proteases 0.0000000127
Further Details:      
 
Domain Number 2 Region: 42-91
Classification Level Classification E-value
Superfamily GLA-domain 7.57e-18
Family GLA-domain 0.00042
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000019096
Domain Number - Region: 98-175
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000251
Family Growth factor receptor domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019096   Gene: ENSNLEG00000015740   Transcript: ENSNLET00000020061
Sequence length 456
Comment pep:known_by_projection supercontig:Nleu1.0:GL397388.1:4728595:4739576:1 gene:ENSNLEG00000015740 transcript:ENSNLET00000020061 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWRLTSLLLFVATWGISGTPAPLDSVFSSSERAHQVLRIRKRANSFLEELRPNSLERECI
EEICDFEEAKEIFQNVDDTLAFWSKHVGPCLVLPLEHPCALCCGHGTCIDDIGSFSCDCR
SGEGRFCQREVSFLNCSLDNGGCTHYCLEEVGWRRCSCAPGYKLGDDLLQCQPAVKFPCG
RPWKRMEKKRSHLKRDTEDQEDQVDPRLIDGKMTRRGDSPWQVVLLDSKKKLACGAVLIH
PSWVLTAAHCMDESRKLLVRLGEYDLRRWEKWELDLDIEEVFVHPNYSKSTTDNDIALLR
LAQPATLSQTIVPICLPDSGLAERELNQAGQETLVTGWGYHSSREKEAKRNRTFVLGGIL
PVVPHNECSEVMSNMVSENMLCAGILGDRQDACEGDSGGPMVASFHGTWFLVGLVSWGEG
CGLLHNYGVYTKVSRYLDWIHGHIRDKEAPPKSWAP
Download sequence
Identical sequences ENSNLEP00000019096 ENSNLEP00000019096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]