SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019114 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019114
Domain Number 1 Region: 30-294
Classification Level Classification E-value
Superfamily C-type lectin-like 3.3e-91
Family Sulfatase-modifying factor-like 0.0000000000903
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019114   Gene: ENSNLEG00000015760   Transcript: ENSNLET00000020081
Sequence length 302
Comment pep:known_by_projection supercontig:Nleu1.0:GL397567.1:444647:462026:1 gene:ENSNLEG00000015760 transcript:ENSNLET00000020081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMPRHGLPLLSLLSLLVGAWLKLGSGQATSMVQLQGGRFLMGTNSPDSRDGEGPVREVTV
KPFAIDIFPVTNKDFRDFVREKKYRTEAEMFGWSFVFEDFVSDELRNKATQPMKPVLWWL
PVEKAFWRQPAGPGSGIRERLEHPVLHVSWNDARAYCAWRGKRLPMEEEWEFAARGGLKG
QVYPWGNRFQPNRTNLWQGKFPKGDKAEDGFHGVSPVNAFPAQNNYGLYDLLGNVWEWTA
SPYQAAEQDMRVLRGASWIDTADGSANHRARVTTRMGNTPDSASDNLGFRCAADAGRPPG
EL
Download sequence
Identical sequences ENSNLEP00000019114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]