SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019126 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000019126
Domain Number - Region: 50-86
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0651
Family C1 set domains (antibody constant domain-like) 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019126   Gene: ENSNLEG00000015790   Transcript: ENSNLET00000020095
Sequence length 107
Comment pep:novel supercontig:Nleu1.0:GL397335.1:710856:711910:-1 gene:ENSNLEG00000015790 transcript:ENSNLET00000020095 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYLSICPGLSFHTLSHSHPSTLAGAHLCAHTTKTTLTPNAHCFNSQHFTVTLTCVHTCFL
NSTATWMLTGSHLCTHTQAHSQTYGGPRSRSFPTGLNKGSGRETCFL
Download sequence
Identical sequences ENSNLEP00000019126 ENSNLEP00000019126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]