SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019133 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019133
Domain Number 1 Region: 29-130
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000224
Family V set domains (antibody variable domain-like) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019133   Gene: ENSNLEG00000015788   Transcript: ENSNLET00000020102
Sequence length 320
Comment pep:known_by_projection supercontig:Nleu1.0:GL397429.1:1494608:1593741:-1 gene:ENSNLEG00000015788 transcript:ENSNLET00000020102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLALAAAALLARAPAPEVCAALNVTVSPGPVVDYLEGENATLLCHVSQKRRKDSLLAV
RWFFAHSSDSQEALMVKMTKLRVVQYYGNFSRSAKRRRLRLLEEQRGALYRLSVLTLQPS
DQGHYVCRVQEISRHRNKWTAWSNGSSATEMRVISLKASEESSFEKTKETWAFFEDLYVY
AVLVCCVGILSILLFMLVIVWQSVFNKRKSRVRHYLVKCPQNSSGETVTSVTSLVPLQPK
KGKRQKEKPDIPPAVPAKAPITPTFHKPKLLKPQRKVTLPKIAEENLTYAELELIKPHRA
AKGTPTSTVYAQILFEENKL
Download sequence
Identical sequences G1S0V1
ENSNLEP00000019133 ENSNLEP00000019133 XP_003278217.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]