SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019170 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019170
Domain Number 1 Region: 180-285
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.81e-22
Family Synaptotagmin-like (S variant) 0.0077
Further Details:      
 
Domain Number 2 Region: 323-527
Classification Level Classification E-value
Superfamily vWA-like 2e-21
Family Integrin A (or I) domain 0.019
Further Details:      
 
Domain Number 3 Region: 2-68
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000171
Family Synaptotagmin-like (S variant) 0.04
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000019170
Domain Number - Region: 111-143
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.00532
Family Ricin B-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019170   Gene: ENSNLEG00000015816   Transcript: ENSNLET00000020139
Sequence length 577
Comment pep:known_by_projection supercontig:Nleu1.0:GL397503.1:806579:828146:1 gene:ENSNLEG00000015816 transcript:ENSNLET00000020139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQVGRTEVVRSSLHPVFSKVFTVDYYFEEVQRLRFEVYDTHGPSGFSCQEDDFLGGMECT
LGQPAQKWLRQVMTRVSVDVLGPAGHCTKHFLCCTESSHLVKTSPSCLLRCDDLCLPRAT
AGPVMWWTCRGGRTQGWQIVAQKKVTRPLLLKFGRNAGKSTITVIAEDISGNNGYVELSF
RARKLDDKDLFSKSDPFLELYRVNDDQGLQLVYRTEVVKNNLNPVWEPFKVSLSSLCSCE
ETRPLKCLVWDYDSRGKHDFIGEFSTTFKEMQKAFGEGQAQWDCVNPKYKQKRRSYKNSG
VVVLADLKFHRVYSFLDYIMGGCQIHFTVAIDFTASNGDPRNSCSLHYINPYQPNEYLKA
LVSVGEICQDYDSDKRFSALGFGARIPPKYEVSHDFAINFNPEDDECEGIQGVVEAYQNC
LPRVQLYGPTNVAPIISKVARVAAAEESSGEASQYYILLILTDGVVTDMADTREAIVRAS
RLPMSIIIVGVGNADFTDMQVLDGDDGVLRSLRGEPALRDIVQFVPFRELKNASPAALAK
CVLAEVPKQVVEYYSHRGLPPRGLGVPAGEASPGCTP
Download sequence
Identical sequences ENSNLEP00000019170 ENSNLEP00000019170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]