SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019197 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019197
Domain Number 1 Region: 14-134
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-29
Family Cadherin 0.0019
Further Details:      
 
Domain Number 2 Region: 243-370
Classification Level Classification E-value
Superfamily Cadherin-like 1.2e-27
Family Cadherin 0.0032
Further Details:      
 
Domain Number 3 Region: 359-464
Classification Level Classification E-value
Superfamily Cadherin-like 7.85e-21
Family Cadherin 0.0054
Further Details:      
 
Domain Number 4 Region: 128-247
Classification Level Classification E-value
Superfamily Cadherin-like 2e-19
Family Cadherin 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019197   Gene: ENSNLEG00000015837   Transcript: ENSNLET00000020169
Sequence length 942
Comment pep:known_by_projection supercontig:Nleu1.0:GL397270.1:5242667:5342992:1 gene:ENSNLEG00000015837 transcript:ENSNLET00000020169 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGEHPRSATVQINVKVIDSNDNSPVFEAPSYLVELPENAPLGTVVIDLNATDADEGPNGE
VLYSFSSYVPDRVRELFSIDPKTGLIRVKGNLDYEENGMLEIDVQARDLGPNPIPAHCKV
TVKLIDRNDNAPSIGFVSVRQGALSEAAPPGTVIALVRVTDRDSGKNGQLQCRVLGGGGT
GGGGGLGGTGGSVPFKLEENYDNFYTVVTDRPLDRETQDEYNVTIVARDGGSPPLNSTKS
FAVKILDENDNPPRFTKGLYVLQVHENNIPGEYLGSVLAQDPDLGQNGTVSYSILPSHIG
DVSIYTYVSVNPTNGAIYALRSFNFEQTKAFEFKVLAKDSGAPAHLESNATVRVTVLDVN
DNAPVIVLPTLQNDTAELQVPRNAGLGYLVSTVRALDSDFGESGRLTYEIVDGNDDHLFE
IDPSSGEIRTLHPFWEDVTPVVELVVKVTDHGKPTLSAVAKLIIRSVSGSLPEGVPRVNG
EQHHWDMSLPLIVTLSTISIILLAAMITIAVKCKRENKEIRTYNCRIAEYSHPQLGGGKG
KKKKINKNDIMLVQSEVEERNAMNVMNVVSSPSLATSPMYFDYQTRLPLSSPRSEVMYLK
PASNNLTVPQGHAGCHTSFTGQGTNASETPATRMSIIQTDNFPAEPNYMGSRQQFVQSSS
TFKDPERASLRDSGHGDSDQADSDQDTNKGSCCDMSVREALKMKTTSTKSQPLEQEPEEC
VNCTDECRVLGHSDRCWMPQFPAANQAENADYRTNLFVPTVEANVETETYETVNPTGKKT
FCTFGKDKREHTILIANVKPYLKAKRALSPLLQEVPSASSSPTKACIEPCTSTKGSLDAC
EAKPGALAEASSQYLPTDSQYLSPSKQPRDPPFMASDQMARVFADVHSRASRDSSEMGAV
LEQLDHPNRDLGRESVDAEEVVREIDKLLQDCRGNDPVAVRK
Download sequence
Identical sequences ENSNLEP00000019197 ENSNLEP00000019197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]