SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019214 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019214
Domain Number 1 Region: 323-544
Classification Level Classification E-value
Superfamily vWA-like 6.85e-52
Family Integrin A (or I) domain 0.00029
Further Details:      
 
Domain Number 2 Region: 163-352
Classification Level Classification E-value
Superfamily vWA-like 6.68e-43
Family Integrin A (or I) domain 0.0012
Further Details:      
 
Domain Number 3 Region: 31-125
Classification Level Classification E-value
Superfamily LCCL domain 4.18e-28
Family LCCL domain 0.00000174
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019214   Gene: ENSNLEG00000015841   Transcript: ENSNLET00000020186
Sequence length 551
Comment pep:known_by_projection supercontig:Nleu1.0:GL397280.1:10058457:10073910:1 gene:ENSNLEG00000015841 transcript:ENSNLET00000020186 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAAWIPALGLGGCAPLTTPAPCSAGSSAPIAITCFTRGLDIRKEKADVLCPGGCPLEEF
SVYGNIVYASVSSICGAAVHRGVISNSGGPVRVYSLPGRENYSSVDANGIQSQMLSRWSA
SFTVTKGKSSTQEATGQAVSTAHPPTGKRLKKTPEKKTGNKDCKADIAFLIDGSFNIGQR
RFNLQKNFVGKVALMLGIGTEGPHVGLVQASEHPKIEFYLKNFTSAKDVLFAIKEVGFRG
GNSNTGKALKHTAQKFFTVDAGVRKGIPKVVVVFIDGWPSDDIEEAGIVAREFGVNVFIV
SVAKPIPEELGMVQDVTFVDKAVCRNNGFFSYHMPNWFGTTKYVKPLVQKLCTHEQMMCS
KTCYNSVNIAFLIDGSSSVGDSNFRLMLEFVSNIAKTFEISDIGAKIAAVQFTYDQRTEF
SFTDYSTKENVLAVIRNIRYMSGGTATGDAISFTVRNVFGPIRESPNKNFLVIVTDGQSY
DDVQGPAAAAHDAGITIFSVGVAWAPLDDLKDMASKPKESHAFFTREFTGLEPIVSDVIR
GICRDFLESQQ
Download sequence
Identical sequences ENSNLEP00000019214 ENSNLEP00000019214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]