SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019224 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019224
Domain Number 1 Region: 699-1005
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.88e-79
Family Protein kinases, catalytic subunit 0.0000000587
Further Details:      
 
Domain Number 2 Region: 167-246
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000343
Family Cadherin 0.011
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000019224
Domain Number - Region: 30-109
Classification Level Classification E-value
Superfamily Cadherin-like 0.0228
Family Cadherin 0.01
Further Details:      
 
Domain Number - Region: 405-504
Classification Level Classification E-value
Superfamily Cadherin-like 0.0286
Family Cadherin 0.012
Further Details:      
 
Domain Number - Region: 260-382
Classification Level Classification E-value
Superfamily Cadherin-like 0.05
Family Cadherin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019224   Gene: ENSNLEG00000015820   Transcript: ENSNLET00000020196
Sequence length 1114
Comment pep:known_by_projection supercontig:Nleu1.0:GL397335.1:1026709:1079273:1 gene:ENSNLEG00000015820 transcript:ENSNLET00000020196 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKATSGAAGLRLLLLLLLPLLGKVALGLYFSRDAYWEKLYVDQPAGTPLLYVHALRDAP
EEVPSFRLGQHLYGTYRTRLHENNWICIQEDTGLLYLNRSLDHSSWEKLSVRNRGFPLLT
VYLKVFLSPTSLGEGECQWPGCARVYFSFFNTSFPACSSLKPRELCFPETRPSFRIRENR
PPGTFHQFRLLPVQFLCPNISVAYRLLEGEGLPFRCAPDSLEVSTRWALDREQREKYELV
AVCTVHASAREEVVMVPFPVTVYDEDDSAPTFPAGVDTASAVVEFKRKEDTVVATLRVFD
ADVVPASGELVRRYTSTLLPGDTWAQQTFRVEHWPNETSVQANGSFVRATVHDYRLVLNR
NLSISENRTMQLAVLVNDSDFQGPGAGVLLLHFNVSVLPVSLHLPSTYSVSVSRRARRFA
QIGKVCVENCQAFSGINVQYELHSSSTNCSMLGVVTSAEDTSGILFVNDTKALRRPKCAE
LHYMVVATDQQTSRQAQAQLLVMVEGSYVAEEAGCPLSCAVSKRRPECEECGGLGSPTGR
CEWRQGDGKGITRNFSTCSPSTKTCPDGHCDVVETQDINICPQDCLRGSIVGGHEPGEPR
GIKAGYGTCNCFPEEEKCFCEPEDIQDPLCDELCRTVIAAAVLFSFIVSVLLSAFCIHRY
HKFAHKPPIPSAEMTFRRPAQAFPVSYSSSGARRPSLDSMENQVSVDAFKIPEDPKWEFP
RKNLVLGKTLGEGEFGKVVKATAFRLKGRAGYTTVAVKMLKENASPSELRDLLSEFNLLK
QVNHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKVGPGYLGSGGSRNSSSLDD
PDERALTMGDLISFAWQISRGMQYLAEMKLVHRDLAARNILVAEGRKMKISDFGLSRDVY
EEDSYVKRSKGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIPPERL
FNLLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMMVKSRDYLDLAA
STPSDSLLYDDGLSEEETPLVDCNNAPLPRALPSTWIENKLYGMSDPNWPGESPVPLTRA
DGTNTGFPRYANDSVYANWMLSPSAAKLMDTFDS
Download sequence
Identical sequences G1S142
ENSNLEP00000019224 XP_003271206.1.23891 ENSNLEP00000019224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]