SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019229 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019229
Domain Number 1 Region: 53-142,324-610
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.74e-55
Family Integrin alpha N-terminal domain 0.0000737
Further Details:      
 
Domain Number 2 Region: 151-329
Classification Level Classification E-value
Superfamily vWA-like 2.23e-41
Family Integrin A (or I) domain 0.0000000168
Further Details:      
 
Domain Number 3 Region: 611-770
Classification Level Classification E-value
Superfamily Integrin domains 4.92e-22
Family Integrin domains 0.0085
Further Details:      
 
Domain Number 4 Region: 829-907
Classification Level Classification E-value
Superfamily Integrin domains 0.0000000131
Family Integrin domains 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019229   Gene: ENSNLEG00000015846   Transcript: ENSNLET00000020201
Sequence length 1163
Comment pep:known_by_projection supercontig:Nleu1.0:GL397496.1:221442:272119:1 gene:ENSNLEG00000015846 transcript:ENSNLET00000020201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDSCITVMAMELLSGFFFFAPGSSYTWTIPAPKHFALPKTGFHHVGQAGLKVIVGAPGE
GNRTGSLYQCQSGTGHCLPVSLRGSNYTSKYLGMTLATDPTDGSVLACDPGLSRTCDQNT
YLSGLCYLFRQNLQGPMLQGHPGFQECIKGNVDLVFLFDGSMSLQPDEFQKILDFMKDVM
KKLSNTSYQFAAVQFSTSYKTEFNFSDYVKRKDPDALLKHVKHMLLLTNTFGAINYVATE
VFREELGARPDATKVLIIITDGEATDSGNIDAAKDIIRYIIGIGKHFQTKESQETLHKFA
SKPASEFVKILDTFEKLKDLFTELQKKIYVIEGTSKQDLTSFNMELSSSGISADLSRGHA
VVGAVGAKDWAGGFLDLKADLQDDTFIGNEPLTPEVRAGYLGYTVTWLPSQEKTLLLASG
APRYQHVGRVLLFQEPRGGGHWSQVQTIHGTQIGSYFGGELCGVDVDQDGETELLLIGAP
LFYGEQRGGRVFIYQRRQLGFEEVSELQGDPGYPLGRFGEAITALTDINGDGLLDVAVGA
PLEEEGAVYIFNGRHGGLSPQPSQRIEGTQVLSGIRWFGRSIHGVKDLEGDGLADVAVGA
ESQMIVLSSRPVVDVVTLMSFSPAEIPVHEVECSFSTSNKMKEGVNITICFQIKSLIPQF
QGHLVANLTYTLQLDGHRTRRRGLFPGGRHELRRNMAVTTSMSCTDFSFHFPVCVQDLIS
PINVSLNFSLWEEEGTPRDQREQGKDIPPILRPSLHSETWEIPFEKNCGEDKKCEANLRV
SFSPARSVRPPTLQPPIHSVLRPPAALTRYVIWRHHFPLLGLTTLPGLAPHSQIPVSCEE
LPEESKLLSRALSCNVSSPIFKAGHSVALQMIFNTVVNSSWGDSVELHANVTCNNEDSGL
LEDNSATTIIPILYPINVLIQDQENSTLYVSFTPKGPKIHQVKHIYQVRIQTSIHDHNIP
TLEAVVGVPQPPSEGPITHQWSVQMEPPVPCHYEDLKRLPDAAEPCLPGALFRCPVVFRQ
DILVQVIGTLELVGEIEASSMFSLCSSLSISFNSSKHFHLYGSNAPLAQVVMKVDVVYEK
QMLYLYVLSGIGGLLLLLLIFIVLYKVGFFKRNLKEKMEAGGGVPNGIPAEDSEQLASGE
EAGDPGCLKPLHEKDSESGDGKD
Download sequence
Identical sequences ENSNLEP00000019229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]