SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019253 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019253
Domain Number 1 Region: 221-317
Classification Level Classification E-value
Superfamily DEATH domain 5.38e-19
Family DEATH domain, DD 0.01
Further Details:      
 
Domain Number 2 Region: 73-102
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000000353
Family TNF receptor-like 0.00035
Further Details:      
 
Domain Number 3 Region: 34-72
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000589
Family TNF receptor-like 0.00015
Further Details:      
 
Domain Number 4 Region: 1-32
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000000191
Family TNF receptor-like 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019253   Gene: ENSNLEG00000015879   Transcript: ENSNLET00000020226
Sequence length 327
Comment pep:known_by_projection supercontig:Nleu1.0:GL397351.1:1289094:1298325:-1 gene:ENSNLEG00000015879 transcript:ENSNLET00000020226 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGHHISEDSRDCISCKYGQDYSTHWNDLLSCLPCTKCDSGEVEVSPCTTTGNTVCQCEEG
TFREEDSPEMCRKCRTGCPRGMVKVSDCTPWSDIECDHKESGTKHSGEAPARFSTCCFYS
SSLLIPFLRVSLSCGGGDPEHVDRSSHSPQQPGAEDDALSETMSILQPTQVPEQEMEVQE
PAELTDVNTLSPGESEHLPEPAEAEGSQRRRLLVPVNEGDPTETLRQCFDDFAVIVPFDS
WEPLMRKLGLMDNEIKVAKAEAAGHRDTLYTMLIKWVNKTGRDASVHTLLDALETLGERL
AKQKIEDQLLSSGKFMYLEGNADSAMS
Download sequence
Identical sequences ENSNLEP00000019253 ENSNLEP00000019253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]