SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019271 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000019271
Domain Number - Region: 55-150
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000366
Family V set domains (antibody variable domain-like) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019271   Gene: ENSNLEG00000015893   Transcript: ENSNLET00000020244
Sequence length 270
Comment pep:known_by_projection supercontig:Nleu1.0:GL397297.1:22300986:22352968:-1 gene:ENSNLEG00000015893 transcript:ENSNLET00000020244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSQPLRWRALPGLPCPPGPPTAPWLLLGLLLLPGTLRLAGGQSVTHTGLPIVASLANTA
VSFSCRITYPYTPQFKVFTVSYFHEDLQGQRSPKKPTNCHPGLGTENQNHTLDCQVTLVL
PGASATGTYYCSVRWPHSTVRGSGTFILVRDAGYREPPQSPQKLLLFGFTGLLSVLSVVG
TALLLWKKKRMRGPGKDPTRKCPDPRSASSPKQHPSESVYTALQRRETEVYACIESEDGS
PPAAKQSPLSQERLYRFEDADELNLVYENL
Download sequence
Identical sequences G1S185
ENSNLEP00000019271 ENSNLEP00000019271 XP_003264880.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]