SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019313 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019313
Domain Number 1 Region: 239-298
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000921
Family Laminin-type module 0.033
Further Details:      
 
Domain Number 2 Region: 309-353
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000103
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 3 Region: 8-90
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000627
Family APC10-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019313   Gene: ENSNLEG00000015930   Transcript: ENSNLET00000020287
Sequence length 373
Comment pep:novel supercontig:Nleu1.0:GL397551.1:499316:516541:-1 gene:ENSNLEG00000015930 transcript:ENSNLET00000020287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQGQYCDICTAANSNKAHPASNAIDGTERWWQSPPLSRGLEYNEVNVTLDLGQVFHVAYV
LIKFANSPRPDLWVLERSMDFGHTYQPWQFFASSKRDCLERFGPQTLERITRDDAAICTT
EYSRIVPLENGEIVVSLVNGRPGAMNFSYSPLLREFTKATNVRLRFLRTNTLLGHLMGKA
LRDPTVTRRYYYSIKDISIGGRLPPPTHACPAHTLTHERAPVPARGGRADSCAPLSLACN
CHGHATDCYYDPEVDRRRASQSLDGTYQGGGVCIDCQHHTTGVNCERCLPGFYRSPDHPL
DSPHVCRRCNCESDFTDGTCEDLTGRCYCRPNFSGERCDVCAKGFTGFPSCYPTPSSSND
TREQVLPAGQIVS
Download sequence
Identical sequences ENSNLEP00000019313 ENSNLEP00000019313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]