SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019361 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019361
Domain Number 1 Region: 125-230
Classification Level Classification E-value
Superfamily Fibronectin type III 5.7e-16
Family Fibronectin type III 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019361   Gene: ENSNLEG00000015949   Transcript: ENSNLET00000020340
Sequence length 459
Comment pep:known_by_projection supercontig:Nleu1.0:GL397362.1:131417:151956:1 gene:ENSNLEG00000015949 transcript:ENSNLET00000020340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTILGTTFGMVFSLLQVVSGESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFE
DPDVNTTNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKAGEKSLTCKK
IDLTTIVKPEVPFDLSVTYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWVH
VNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEINNSSGEMDP
ILLTISILSFFSVALLVILACVLWKKRIKPIVWPSLPDHKKTLEHLCKKPRKNLNVSFNP
ESFLDCQIHRVDDIQARDEVEGFLQDTFPQQLEESEKQRLGGDVQSPNCPSEDVVITPES
FGRDSSLTCLAGNVSACDAPILSSSRSLDCKESGNNGPHVYQDLLLSLGTTNSTLPPPFS
LQSGILTLNPVAQGQPILTSLGSNQEEAYVTMSSFYQNQ
Download sequence
Identical sequences G1S1H3
ENSNLEP00000019361 XP_003274389.1.23891 ENSNLEP00000019361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]