SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019366 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019366
Domain Number 1 Region: 121-158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000314
Family Cripto EGF-like domain-like 0.0061
Further Details:      
 
Domain Number 2 Region: 88-117
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000273
Family EGF-type module 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019366   Gene: ENSNLEG00000015963   Transcript: ENSNLET00000020346
Sequence length 223
Comment pep:novel supercontig:Nleu1.0:GL397428.1:2526970:2533766:1 gene:ENSNLEG00000015963 transcript:ENSNLET00000020346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTWRHHVRLLFTVSLALQIINLGNSYQREKHNGGREEVTKVATQKHQQSPLNWTSSHLGE
VTGSAEGWGPEEPLPYSRAFGEGAFARPRCCRNGGTCVLGSFCVCPAHFTGRYCEHDQRR
SECGALEHGAWTLRGCHLCRCIFGALHCLALQMPGRCDPKDFLASHAHGPSAGGAPSLLL
LLPCALLHRLLRPDAPAHPGSLVPSVLQRERRPCRRPGLGHRL
Download sequence
Identical sequences G1S1H8
ENSNLEP00000019366 XP_003278199.1.23891 ENSNLEP00000019366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]