SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019422 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019422
Domain Number 1 Region: 7-179
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 3.15e-62
Family MHC antigen-recognition domain 0.00000536
Further Details:      
 
Domain Number 2 Region: 184-264
Classification Level Classification E-value
Superfamily Immunoglobulin 6.03e-24
Family C1 set domains (antibody constant domain-like) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019422   Gene: ENSNLEG00000016013   Transcript: ENSNLET00000020404
Sequence length 318
Comment pep:novel supercontig:Nleu1.0:GL397275.1:31761224:31855166:1 gene:ENSNLEG00000016013 transcript:ENSNLET00000020404 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQGRTLLRYFGLGISDPGHGVPEFISVGYVDSHPITTYDSVTRQKEPRAPWMAENLAPDH
WERGTQLLRGWQQTFKVELKRLQRHYNHSGSHLPRMIGCEVLKDGSTTGFLQYAYDGQDF
LIFNKDTLSWLAVDNVAHTIKRAWEANQHELQYQKNWLEEECIAWLKRFLEYGKDTRQRT
EPPLVRVNRKETFPGVTTLFCKAHGFYPPEIYMTWMKNGEEIVQEMDYGDILPSGDGTYQ
MWASVELDPQSSNLYSCHVEHCGVHMVLQVPQESETIPLVMKAISGSIVLVIVLAGVGVL
VWRRRPEQNGAIYLPAPD
Download sequence
Identical sequences ENSNLEP00000019422 ENSNLEP00000019422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]