SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019443 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019443
Domain Number 1 Region: 6-270
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 8.45e-93
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000533
Further Details:      
 
Domain Number 2 Region: 271-470
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 2.75e-62
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.0000166
Further Details:      
 
Domain Number 3 Region: 650-760
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 9.03e-17
Family AlaX-like 0.035
Further Details:      
 
Domain Number 4 Region: 523-603
Classification Level Classification E-value
Superfamily Translation proteins 0.0000000000000219
Family AlaX-M N-terminal domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019443   Gene: ENSNLEG00000016030   Transcript: ENSNLET00000020428
Sequence length 784
Comment pep:known_by_projection supercontig:Nleu1.0:GL397515.1:27062:61457:-1 gene:ENSNLEG00000016030 transcript:ENSNLET00000020428 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSTLTASEIRQRFIDFFKRNEHTYVHSSATIPLDDPTLLFANAGMNQFKPIFLNTIDPS
HPMAKLSRAANTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGSWSFGDYFKELACKMALE
LLTQEFGIPVERLYVTYFGGDEAAGLEPDLECKQIWQNLGGCNWAYLYSFVRLDDTKILP
GNMKDNFWEMGDTGPCGPCSEIHYDRIGGRDAAHLVNQDDPNVLEIWNLVFIQYNREADG
ILKPLPKKSIDTGMGLERLVSVLQNKMSNYDTDLFVPYFEAIQKGTGARPYTGKVGAEDA
DGIDMAYRVLADHARTITVALADGGRPDNTGRGYVLRRILRRAVRYAHEKLNASRGFFAT
LVDVVVQSLGDAFPELKKDPDMVKDIINEEEVQFLKTLSRGRRILDRKIQSLGDSKNIPG
DTAWLLYDTYGFPVDLTGLIAEEKGLVVDMDGFEEERKLAQLKSQGKGAGGEDLIMLDIY
AIEELRARGLEVTDDSPKYNYHLDSSGSYVFETPVATDALRREKMFVEEVSTQECGVVLD
KTCFYAEQGGQIYDEGYLVKVDDSSEDKTEFTVKNAQVRGGYVLHIGTIYGDLKVGDQVR
LFIDEPPLDLVSNHLLLWLYIVLSLLGQVRWLTPVIPALWEAEAGGSRGQEIETILDNMG
ETPSPVYTQDCPLAAAKGIQGLRAVFDETYPDPVRVVSIGVPVSELLDDPSGPAGSLTSV
EFCGGTHLRNSSHAGAFVIVTEEAIAKGIRRIVAVTGAEAQKVSRSGWFVAYLKKARGAQ
SANP
Download sequence
Identical sequences ENSNLEP00000019443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]