SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019474 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019474
Domain Number 1 Region: 414-564
Classification Level Classification E-value
Superfamily TRAF domain-like 2.62e-50
Family MATH domain 0.0000000357
Further Details:      
 
Domain Number 2 Region: 364-413
Classification Level Classification E-value
Superfamily Trimerization domain of TRAF 1.57e-20
Family Trimerization domain of TRAF 0.0000865
Further Details:      
 
Domain Number 3 Region: 112-211
Classification Level Classification E-value
Superfamily TRAF domain-like 2.94e-16
Family SIAH, seven in absentia homolog 0.016
Further Details:      
 
Domain Number 4 Region: 42-99
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000128
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 5 Region: 212-253
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0000163
Family SIAH, seven in absentia homolog 0.011
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000019474
Domain Number - Region: 270-410
Classification Level Classification E-value
Superfamily Tropomyosin 0.00281
Family Tropomyosin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019474   Gene: ENSNLEG00000016049   Transcript: ENSNLET00000020460
Sequence length 568
Comment pep:known_by_projection supercontig:Nleu1.0:GL397390.1:2280567:2358183:1 gene:ENSNLEG00000016049 transcript:ENSNLET00000020460 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESSKKMDSPGSLQTNPPLKLHADRSAGTPVFVPEQGGYKEKFVKTVEDKYKCEKCRLVL
CSPKQTECGHRFCESCMAALLSSSSPKCTACQESIVKDKVFKDNCCKREILALQIYCRNE
SRGCAEQLTLGHLLVHLKNDCHFEELPCVRADCKEKVLRKDLRDHVEKACKYREATCSHC
KSQVPMIALQKHEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCV
FQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEI
EIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNR
VTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIW
KIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRG
EYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQ
TVLENGTYIKDDTIFIKVIVDTSDLPDP
Download sequence
Identical sequences G1S1T6
ENSNLEP00000019474 XP_012353606.1.23891 ENSNLEP00000019474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]