SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019592 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019592
Domain Number 1 Region: 58-301
Classification Level Classification E-value
Superfamily Caspase-like 6.28e-95
Family Caspase catalytic domain 0.000000000221
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019592   Gene: ENSNLEG00000016148   Transcript: ENSNLET00000020582
Sequence length 303
Comment pep:known_by_projection supercontig:Nleu1.0:GL397265.1:47635535:47697357:1 gene:ENSNLEG00000016148 transcript:ENSNLET00000020582 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADDQGCVEEQGVGDSANEDSVDAKPDRSSFVPSLFSKKKKNVSMRSIKTTRDRVPTYQY
NMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQ
DLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKL
FFIQACRGTELDDGIQADSGPINETDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSW
FVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPRFHEKKQIPCVVSMLTKELY
FSQ
Download sequence
Identical sequences G1S254
ENSNLEP00000019592 XP_003255531.1.23891 XP_003255532.1.23891 XP_003255534.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]