SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019726 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019726
Domain Number 1 Region: 1288-1404
Classification Level Classification E-value
Superfamily Cadherin-like 4.71e-31
Family Cadherin 0.0012
Further Details:      
 
Domain Number 2 Region: 854-957
Classification Level Classification E-value
Superfamily Cadherin-like 4.71e-27
Family Cadherin 0.001
Further Details:      
 
Domain Number 3 Region: 1186-1293
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-26
Family Cadherin 0.0011
Further Details:      
 
Domain Number 4 Region: 419-535
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-25
Family Cadherin 0.0013
Further Details:      
 
Domain Number 5 Region: 528-634
Classification Level Classification E-value
Superfamily Cadherin-like 1.38e-24
Family Cadherin 0.0009
Further Details:      
 
Domain Number 6 Region: 1390-1515
Classification Level Classification E-value
Superfamily Cadherin-like 8.57e-24
Family Cadherin 0.0012
Further Details:      
 
Domain Number 7 Region: 324-417
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-23
Family Cadherin 0.0025
Further Details:      
 
Domain Number 8 Region: 636-750
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-23
Family Cadherin 0.0013
Further Details:      
 
Domain Number 9 Region: 7-98
Classification Level Classification E-value
Superfamily Cadherin-like 5.85e-20
Family Cadherin 0.0019
Further Details:      
 
Domain Number 10 Region: 1077-1185
Classification Level Classification E-value
Superfamily Cadherin-like 1.31e-19
Family Cadherin 0.0023
Further Details:      
 
Domain Number 11 Region: 95-218
Classification Level Classification E-value
Superfamily Cadherin-like 7.57e-19
Family Cadherin 0.0049
Further Details:      
 
Domain Number 12 Region: 205-290
Classification Level Classification E-value
Superfamily Cadherin-like 7e-18
Family Cadherin 0.0023
Further Details:      
 
Domain Number 13 Region: 744-860
Classification Level Classification E-value
Superfamily Cadherin-like 8.99e-17
Family Cadherin 0.001
Further Details:      
 
Domain Number 14 Region: 958-1076
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-16
Family Cadherin 0.00093
Further Details:      
 
Domain Number 15 Region: 1501-1600
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000328
Family Cadherin 0.002
Further Details:      
 
Domain Number 16 Region: 1625-1743
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000228
Family Cadherin 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019726   Gene: ENSNLEG00000016188   Transcript: ENSNLET00000020718
Sequence length 2146
Comment pep:novel supercontig:Nleu1.0:GL397335.1:5969274:6059066:1 gene:ENSNLEG00000016188 transcript:ENSNLET00000020718 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFTQQQYSRLGLRETAGIGTSVIVVQATDRDSGDGGLVNYRILSGAEGKFEIDESTGLII
TMDYLDYETKTSYVMNVSATDQAPPFNQGFCSVYITLLNELDEAVQFSNASYEAAILENL
ALGSEIVRVQAYSIDNLNQITYRFDAYTSAQAKALFKIDAITGVITVQGLVDREKGDFYT
LTVVADDGGPKVDSTVVYITVLDENDNSPRFDFTSDSAVSVPEDCPVGQRVATVKAWDPD
AGSNGQVVFSLASGNIVGAFEMVTTNDSIGEVFVARPLDREELDHYILKVGPGLPWAERP
QAKCLDRSLLSSQERTFIESPFGYNVSVNENVGGGTAVVQVRATDHDIGINSVLSYYITE
GNKDMTFRMDRISGEIATRPAPPDRERQSFYHLVVTVEDEGTPTLSATTQVYVTIVDEND
NAPMFQQPHYEVLLDEGPDTLNTSLITIQALDLDEGPNGTVTYAIVAGNIINTFRIDRHM
GVINAAKELDYEISHGRYTLIVTATDQCPILSHRLTSTTTVLVNVNDINDNMPTFPRDYE
GPFEVTEGQPGPRVWTFLAHDQDSGPNGQVEYSIVDGDPLGEFVISPVEGVLRVRKDVEL
DRETIAFYNLTICARDRGMPPLSSTMLVGIRVLDINDNDPVLLNLPMNITISENSPVSSF
VAHILASDADSGCNARLTFNITAGNRERAFFINATTGIVTVNRPLDREQIPEYKLTISVK
DNPENPRIARRDYDLLLIFLSDENDNHPLFTKSTYQAEVMENSPAGTPLTVLNGPILALD
ADQDIYAVVTYQLLGAQSGLFDTNSSTGVVTVRSGVIIDREAFSPPILELLLLAEDIGLL
NSTAHLLITILDDNDNWPIFSPATLTVHLLENCPPGFSVLQVTATDEDSGLNGELVYRIE
AGAQDRFLIHPVTGVIRVGNATIDREEQESYRLTVVATDRGTVPLSGTAIVTMLIDDIND
SRPEFLNPIQTVSVLESAEPGTVIANITAIDRDLNPKLEYHIVGIVAKDDTDRLVPDQED
AFAVNINTGSVMVKSPMNRELVATYEVTLSVIDNASDLPELSVSVPNAKLTVNVLDVNDN
TPQFKPFGITYYTERILEGATPGTTLIAVAAVDPDKGLNGLVTYTLLDLVPPGYVQLEDP
SAGKVIANQTVDYEEVHWLNFTVRASDNGSPPRAAEIPVYLEIMDINDNNPIFDQPSYQE
AVFEDVPVGTIILTVTATDADSGNFALIEYSLGDGESKFAINPTTGDIYVLSSLDREKKD
HYILTALAKDNPGDVASNRRENSVQVVIQVLDVNDCRPQFSKPQFSTSVYENEPAGTSVI
TMMATDQDEGHNGELTYSLEGPGVEAFHVDMDSGLVTTQRPLQSYERFNLTVVATDGGDP
PLWGTTMLLVEVIDVNDNRPVFVRPPNGTILHIREEIPLRSNVYEVYATDKDEGLNGAVR
YSFLKTAGNRDWEFFTIDPISGLIQTAQRLDRESQAVYSLILVASDLGQPVPYETMQPLQ
VALEDIDDNEPLFVRTPKGSPQYQLLTVPEHSPHGTLVGNVTGAVDADEGPNAIVYYFIA
AGNEEKNFHLQPDGRLLVLRDLDREREAIFSFIVKASSNRSWTPPRGPYPTLDLVADLTL
QEVRVVLEDINDQPPRFTKAEYTAGVATDAKVGSELIQVLALDADIGNNSLVFYSILAIH
YFRALANDSEDVGQVFTMGSVDGILRTFDLFMAYSPGYFVVDIVARDLAGHNDTAIIGIY
ILRDDQRVKIVINEIPDRVRGFEEEFIHLLSNITGAIVNTDDVQFHVDKKGRVNFAQTEL
LIHVVNRDTNRILDVDRVIQMIDENKEQLRNLFRNYNVLDVQPAISVRLPDDMSALQMAI
IILAILLFLAAMLFVLMNWYYRTVHKRKLKAIVAGSAGNRGFIDIMDMPNTNKYSFDGAN
PVWLDPFCRNLELAAQAEHEDDLPENLSEIADLWNSPTRTHGTFGREPAAIKPDDDRYLR
AAIQEDYGGLLQPAVALKAGLRNGSLLKVVLEDYLRLKKLFAQRMVQKASSCHSSISELI
QTELDEEPGDHSPGQGSLRFHHKPPVELKGPDGIHVVHGSTGTLLATDLNSLPEDDQKGL
GRSLETLTAAEATAFERNARTESAKSTPLHKLHDVIMESPLEITEL
Download sequence
Identical sequences ENSNLEP00000019726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]