SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019756 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019756
Domain Number 1 Region: 830-912
Classification Level Classification E-value
Superfamily DEATH domain 4.47e-22
Family DEATH domain, DD 0.00000813
Further Details:      
 
Domain Number 2 Region: 131-222
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000174
Family I set domains 0.017
Further Details:      
 
Domain Number 3 Region: 221-272
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000017
Family TSP-1 type 1 repeat 0.0006
Further Details:      
 
Domain Number 4 Region: 274-329
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000183
Family TSP-1 type 1 repeat 0.0006
Further Details:      
 
Domain Number 5 Region: 24-126
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000295
Family I set domains 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019756   Gene: ENSNLEG00000016277   Transcript: ENSNLET00000020750
Sequence length 920
Comment pep:known_by_projection supercontig:Nleu1.0:GL397335.1:5513412:5533692:1 gene:ENSNLEG00000016277 transcript:ENSNLET00000020750 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAGTDSGSEVLPDSFPSAPAEPLPYFLQEPQDAYIVKNKPVELRCRAFPATQIYFKCNGE
WVSQNDHVTQEGLDEATGLQVREVQIEVSRQQVEELFGLEDYWCQCVAWSSAGTTKSRRA
YVRIAYLRKNFDQEPLGKEVPLDHEVLLQCRPPEGVPVAEVEWLKNEDVIDPTQDTNFLL
TIDHNLIIRQARLSDTANYTCVAKNIVAKRRSTTATVIVYVNGGWSSWAEWSPCSNRCGR
GWQKRTRTCTNPAPLNGGAFCEGQAFQKTACTTICPVDGAWTEWSKWSACSTECAHWRSR
ECMAPPPQNGGRDCSGTLLDSKNCTDGLCMQNKKTLSDPNSHLLEASGDAALYAGLVVAV
FVVVAILMAVGVVVYRRNCRDFDTDITDSSAALTGGFHPANFKTARPSNPQLLHPSVPPD
LTASAGIYRDPVYALQDSTDKIPTNSPLLDPLPSLKVKVXXXXXXXXXXXXXXXXXXMGV
LPSGTYPSDFARDTHFLHLRSASLGSQQLLGLPRDPGSSVSSTFGCLGGRLSIPGTGVSL
LVPNGAIPQGKFYEMYLLINKAESTLPLSEGTQTVLSPSVTCGPTGLLLCRPVILTMPHC
AEVSAGDWIFQLKTQAHQGHWEEVVTLDEETLNTPCYCQLEPRACHILLDQLGTYVFTGE
SYSRSAVKRLQLAVFAPALCTSLEYSLRVYCLEDTPVALKEVLELERTLGGYLVEEPKPL
VFKDSYHNLRLSLHDLPHAHWRSKLLAKYQEIPFYHIWSGSQKALHCTFTLERHSVASTE
LTCKICVRQVEGEGQIFQLHTTVAETPAGSLDTLCSAPGSTITTQLGPYAFKIPLSIRQK
ICNSLDAPNSRGNDWRMLAQKLSMDRYLNYFATKASPTGVILDLWEALQQDDGDLNSLAS
ALEEMGKSEMLVAVATDGDC
Download sequence
Identical sequences ENSNLEP00000019756 ENSNLEP00000019756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]