SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019764 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019764
Domain Number 1 Region: 15-121,310-614
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.96e-58
Family Integrin alpha N-terminal domain 0.00019
Further Details:      
 
Domain Number 2 Region: 103-332
Classification Level Classification E-value
Superfamily vWA-like 5.04e-50
Family Integrin A (or I) domain 0.0000000211
Further Details:      
 
Domain Number 3 Region: 614-763
Classification Level Classification E-value
Superfamily Integrin domains 5.13e-24
Family Integrin domains 0.012
Further Details:      
 
Domain Number 4 Region: 953-1096
Classification Level Classification E-value
Superfamily Integrin domains 0.00000000628
Family Integrin domains 0.016
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000019764
Domain Number - Region: 879-923
Classification Level Classification E-value
Superfamily Integrin domains 0.00167
Family Integrin domains 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019764   Gene: ENSNLEG00000016289   Transcript: ENSNLET00000020758
Sequence length 1155
Comment pep:known_by_projection supercontig:Nleu1.0:GL397496.1:997255:1045056:1 gene:ENSNLEG00000016289 transcript:ENSNLET00000020758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSRILPLALTLCHGFNLDTENAMTFQENARGFGQSVVQLQGSRVVVGAPQEILADNQRGS
LYQCDYSIGSCEPIHLQVPVEAVNMSLGLSLAATTSPPQLLACGPTVHQTCSENTYVKGL
CFLFGSNLRQQPQKFPEALRGCPQEDSDIAFLIDGSGSINPNDFQKMKEFVSTVMEQLKK
SKTLFSLMQYSEEFWTHFTFKEFQDNPNPRSLVKPIMQLFGRTHTATGIRKVVRELFNIT
QGARKNAFKILVVITDGEKFGDPLGYEDVIPEADREGVIRYVIGVGDAFHSMNSRQELNT
IASKPPRDHVFQVNNFEALKTIQNQLREKIFAIEGTQTGSSSSFEHEMSQEGFSTAITSN
GLLLSTVGSYDWAGGAFLYTSKEKSTFINMTRVDSDMNDAYLGNALGIALKTETSIFFFF
FLRWSFFLVAQAREKTPTSALGGKRYVIMIGAYFGASLCSVDVDSNGSTDLVLIGAPHYY
EQTRGGQVSMCPLPRGQRARWQCDAVLYGEQGQPWGRFGAALTVLGDVNGDKLTDVAIGA
PGEEDNRGAVYLFHGTLGLGINPSHSQRIAGSKLSPRLQYFGQSLSGGQDLTMDGLVDLT
VGAQGHVLLLRSQPVLRVKAIMEFNPREVARNVFECNDQVVKGKEAGEVRVCLHVQKSTR
DRLTEGQIQSVVTYDLALDSGRTHSRAVFNETKNNTRRGTQVLGLTQTCETLKLQLPNCV
EDPVRPIVLHLNFSLVGTPLSAFGNLRPVLAEDAQRLFTALVSPELGSCGGVEETRDQRL
KCSGAILAHCNLRLPGLSDSCASLSQAAGVTCACHHTQLIFVFLVDTGFCHVGQTGLELL
TSGDPPASASQSAGITGMTGIWVISSLLFLHCLSFLPLQVTFNITFDVDSKASLGNKLLL
KAKVTSENNMPRTNKTEFQLELPVKYAVYMVVTSHEVSTKYLSFTASENTSQVMQHQYQV
SNLGQRSLPISLVFLVPVRLNQAIIWDRPQVTFPENLSSTCHTKERLPLHSDFLAELRKA
PLVNCAIAVCHRIQCDFPFFGIQEEFNATLKGNLSFDWYIKTSHNHLLVVSTAEILFNDS
TFTLLPGQGAFVRAQTETKVEPFEVPNPLPLIVGSSVGGLMLLALITAALYKLGFFKRQY
KDMMSEGGPPGAEPQ
Download sequence
Identical sequences ENSNLEP00000019764 ENSNLEP00000019764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]