SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019782 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019782
Domain Number 1 Region: 34-148
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000809
Family V set domains (antibody variable domain-like) 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019782   Gene: ENSNLEG00000016308   Transcript: ENSNLET00000020778
Sequence length 311
Comment pep:known_by_projection supercontig:Nleu1.0:GL397335.1:5993189:6015543:-1 gene:ENSNLEG00000016308 transcript:ENSNLET00000020778 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFPTAPEAGRWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPV
DKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLE
SASDHHGNFSITMRNLTLLDSGLYCCLVVELRHHHSEHRVHGAMELQVQTGKDAPSNCVA
YPSSSQESENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGI
ENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLD
PVPDSPNFEVI
Download sequence
Identical sequences A0A2I3H3T3
ENSNLEP00000019782 XP_003271258.1.23891 ENSNLEP00000019782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]