SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019785 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019785
Domain Number 1 Region: 819-1107
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-82
Family Protein kinases, catalytic subunit 0.0000000000392
Further Details:      
 
Domain Number 2 Region: 449-636
Classification Level Classification E-value
Superfamily Fibronectin type III 1.48e-16
Family Fibronectin type III 0.0036
Further Details:      
 
Domain Number 3 Region: 638-733
Classification Level Classification E-value
Superfamily Fibronectin type III 2.49e-16
Family Fibronectin type III 0.003
Further Details:      
 
Domain Number 4 Region: 370-448
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000899
Family I set domains 0.039
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000019785
Domain Number - Region: 220-337
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000895
Family Growth factor receptor domain 0.0073
Further Details:      
 
Domain Number - Region: 132-222
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0164
Family I set domains 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019785   Gene: ENSNLEG00000016282   Transcript: ENSNLET00000020782
Sequence length 1124
Comment pep:known_by_projection supercontig:Nleu1.0:GL397294.1:185032:311295:-1 gene:ENSNLEG00000016282 transcript:ENSNLET00000020782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSLASLVLCGVSLLLSGTVEGAMDLILINSLPLVSDAETSLTCIASGWRPHEPITIGRD
FEALMNQHQDPLEVTQDVTREWAKKVVWKREKASKINGAYFCEGRVRGEAIRIRTMKMRQ
QASFLPATLTMTVDKGDNVNISFKKVLIKEEDAVIYKNGSFIHSVPRHEVPDILEVHLPH
AQPQDAGVYSARYIGGNLFTSAFTRLIVRRCEAQKWGPECNHLCTACMNNGVCHEDTGEC
ICPPGFMGRTCEKACELHTFGRTCKERCSGQEGCKSYVFCLPDPYGCSCATGWKGLQCNE
ACHPGFYGPDCKLRCSCNNGEMCDRFQGCLCSPGWQGLQCEREGIPRMTPKIVDLPDHIE
VNSGKFNPICKASGWPLPTNEEMTLVKPDGTVLHPKDFNRTDHFSVAIFTIHRILPPDSG
VWVCSVNTVAGMVEKPFNISVKVLPKPLNAPNVIDTGHNFAVINISSEPYFGDGPIKSKK
LLYKPVNHYEAWQHIQVTNEIVTLNYLEPRTEYELCVQLVRRGEGGEGHPGPVRRFTTAS
IGLPPPRGLNLLPKSQTTLNLTWQPIFPSSEDDFYVEVERRSVQKSDQQNIKVPGNLTSV
LLNNLHPREQYVVRARVNTKAQGEWSEDLTAWTLSDILPPQPENIKISNITHSSAVISWT
ILDGYSISSITIRYKVQGKNEDQHIDVKIKNATITQYQLKGLEPETAYQVDIFAENNIGS
SNPAFSHELVTLPESQAPADLGGGKMLLIAILGSAGMTCLTVLLAFLIILQLKRANVQRR
MAQAFQNVREEPAVQFNSGTLALSRKVKNNPDPTIYPVLDWNDIKFQDVIGEGNFGQVLK
ARIKKDGLRMDAAIKRMKEYASKDDHRDFAGELEVLCKLGHHPNIINLLGACEHRGYLYL
AIEYAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQF
IHRDLAARNILVGENYVAKIADFGLSRGQEVYVKKTMGRLPVRWMAIESLNYSVYTTNSD
VWSYGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPY
ERPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGIDCSAEEAA
Download sequence
Identical sequences G1S2P7
ENSNLEP00000019785 XP_003264037.1.23891 ENSNLEP00000019785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]