SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019789 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019789
Domain Number 1 Region: 59-165,352-656
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.7e-64
Family Integrin alpha N-terminal domain 0.0000619
Further Details:      
 
Domain Number 2 Region: 147-374
Classification Level Classification E-value
Superfamily vWA-like 4.13e-50
Family Integrin A (or I) domain 0.000000039
Further Details:      
 
Domain Number 3 Region: 813-958
Classification Level Classification E-value
Superfamily Integrin domains 1.67e-29
Family Integrin domains 0.0038
Further Details:      
 
Domain Number 4 Region: 656-811
Classification Level Classification E-value
Superfamily Integrin domains 3.92e-29
Family Integrin domains 0.0072
Further Details:      
 
Domain Number 5 Region: 989-1135
Classification Level Classification E-value
Superfamily Integrin domains 0.00000000000146
Family Integrin domains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019789   Gene: ENSNLEG00000016300   Transcript: ENSNLET00000020786
Sequence length 1193
Comment pep:known_by_projection supercontig:Nleu1.0:GL397496.1:1062013:1094918:1 gene:ENSNLEG00000016300 transcript:ENSNLET00000020786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTTFFLPLATSLPTYFLVPWSSSACNGSGAQSSTSDLVMTRTRAALLLFTALATSLGFN
LDTEELTAFHVDSAGFGDSVVQYANSWVVVGAPQKITAANQTGGLYQCGYSTGACEPIGL
QVPLEAVNMSLGLSLAATTSPSQLLACGPTVHHACGRNMYLTGLCFLLAAAQLTQRLPAS
RQECPRQEQDIVFLIDGSGSISSGNFATMMNFVRAVISQFQRPSTQFSLMQFSNRFETHF
TFEKFRRSSNPLSLLASVRQLGGLTYTATAIQKVVHQLFHASYGARRDATKILIVITDGK
KEGDSLDYKHVIPMADAAGIIRYAIGVGSAFQNTNSWKELNDIASKPSQEHIFKVEDFDA
LKDIQNQLKEKIFAIEGTETTSSSSFELEMAQEGFSAVFTPDGPVLGAVGSFTWSGGAFL
YPPNMSPTFINMSQENVDMRDSYLGYSTELALWKGVQSLVLGAPRYQHTGKAVIFTQVSR
QWRMKAEVMGTQIGSYFGASLCSMDVDSDGSTDLVLIGAPHYYEQTRGGQVSVCPLPRGW
RRWWCDAVLYGEQGHPWGRFGAALTVLGDVNGDKLTDVAIGAPGEEENRGAVYLFHGVLG
PSISPSHSQRIAGSQLSSRLQYFGQALSGGQDLTQDGLVDLAVGARGQVLLLRTRPVLWV
QVSMKFIPAEIPRSVFECREQVVSDQILGQSSICLYIDTSSKNLLRSRDLQSSVTLDLAL
DPGRLSPRATFQETKNRSLSRVRVLGLETHCENFNLLLPTCVEDSVTPITLRLNFTLMGK
PLPAFRNLRPMLAADAQRYFTASLPFEKNCGADHICQDDLGISFSFPGLKTLLVGSNLEL
NTEVMVWNDGEDSYGTTITFSHPAGLSYRYVAEGQKQRQLRSLRLTCDSAPAGSQGTWST
SCRINHLVFRGGAQITFVATFDVSPKAVLGDRLLLTANVSSENNTPRTSKTSFQLELPVK
YAVYAVASSHEQFTKYLNFSESEEKESRVAMHRYQVNNLGQRDLPVSINFWVPVELNQEA
VWMDVEVSHPQNPSLWCSSEKIAPPASDFLAHIQKNPVLDCSIAGCLRFRCDVPSFSVQE
ELDFTLKGNLSFGWVRQTSQKKVSVVSVAEITFNTSVYSQLPGQEAFMRAQTTTVVEKYK
VHNPTPLIVGSSIGGLLLLALITAVLYKVGFFKRQYKEMMEEANGQIAPENGT
Download sequence
Identical sequences ENSNLEP00000019789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]