SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019802 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019802
Domain Number 1 Region: 18-124,309-609
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 2.35e-30
Family Integrin alpha N-terminal domain 0.0011
Further Details:      
 
Domain Number 2 Region: 609-762
Classification Level Classification E-value
Superfamily Integrin domains 1.2e-28
Family Integrin domains 0.0044
Further Details:      
 
Domain Number 3 Region: 764-909
Classification Level Classification E-value
Superfamily Integrin domains 1.26e-28
Family Integrin domains 0.0062
Further Details:      
 
Domain Number 4 Region: 107-255
Classification Level Classification E-value
Superfamily vWA-like 1.1e-23
Family Integrin A (or I) domain 0.00013
Further Details:      
 
Domain Number 5 Region: 941-1081
Classification Level Classification E-value
Superfamily Integrin domains 0.0000000413
Family Integrin domains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019802   Gene: ENSNLEG00000016324   Transcript: ENSNLET00000020799
Sequence length 1156
Comment pep:known_by_projection supercontig:Nleu1.0:GL397496.1:1101511:1136173:1 gene:ENSNLEG00000016324 transcript:ENSNLET00000020799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTFGTVLLLSVLASYHGFNLDVEEPTIFQEDAGGFGQSVVQFGGSRLVVGAPLEVVAANQ
TGRLYDCAAATGMCQPIPLHIRPEAVNMSLGLTLAASTNSSWLLACGPTLHRVCGENSYS
KGSCLLLGSRWEIIQTVPDAPPECPHQETDIVFLIDGSGSIDQNDFNQMKGFVQAVMGQF
EGTDTLFALMQYSNLLKIHFTFTQYRTSPSQQSLVDPIVQLKGLTFTATGMLKVVSYQRM
EQSGTQELSPKVVLVHFSPLTSSPASLTPAHPLSSAEGRGSLASSTHLWERPWVTRESPS
GVSTSPLKVLPVDNFAALGSIQKQLQEKIYAVEGTQSRASSSFQHEMSQEGFSAAVTMDG
LFLGAMGRFSWSGGAFLYPPNMSPTFINMSQENVDMRDSYLGYSTELALWKGVQNLVLGA
PRYQHTGKAVIFTQVSRQWRMKAKVTGTQIGSYFGASLCLVLKFIQAIDLILTPPNHITN
RDQVSVCPLPRGVWLMGPRLGVWCGWRHRLGWEGAVAALVGDICSQLTPSLPLPRSYVHI
PLVTYFQLLPPSSSLIHPSSGQRIAGSQLSPRLQYFGQALSGGQDLTQDGLMDLAVGARG
QVLLLRSLPVLKVGVAMRFSPVEVAKAVYRCWEERPSALEAGDATVCLTIQKSSLDQLGD
IRSSVRFDLALDPGRLTSRAIFNETKNPTLTRRKALGLGVHCETLKLLLPDCVEDVVSPI
ILHLKFSLVREPIPSPQNLRPVLAVGSQDLFTASLPFEKNCGQDGLCEGDLGVTLSFSGL
QTLTVGSSLELNVIVTVWNAGEDSYGTVVSLYYPAGLSHRRVSGAQKQPHQCALRLACET
VPTEDEGLRSSRCSVNHPIFHEGSNGTFIVTFDVSYKATLGDRMLMRASASSKNNKASSS
KATFQLELPVKYAVYTMISRQEESTKYFNFATSDEKKMKEAEHRYRVNNLSQRDLAISIN
FWVPVLLNGVAVWDVVMEAPSQSLPCVSERKPPQHSDFLTQISRSPMLDCSIAGCLRFRC
DVPTFSVQEELDFTLKGNLSFGWVRETSQKKVSVVSVAEITFNTSVYSQLPGQEAFMRAQ
MEMVLEEYEVYNAIPIIMGSSVGALLVLALITATLYKASLGFFKRHYKEMLEDKPEDTAT
FSGDDFSCVAPNVSLS
Download sequence
Identical sequences ENSNLEP00000019802 ENSNLEP00000019802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]