SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019831 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019831
Domain Number 1 Region: 336-523
Classification Level Classification E-value
Superfamily Fibronectin type III 1.79e-18
Family Fibronectin type III 0.0032
Further Details:      
 
Domain Number 2 Region: 540-735
Classification Level Classification E-value
Superfamily Fibronectin type III 6.18e-17
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 3 Region: 228-324
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000363
Family Fibronectin type III 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019831   Gene: ENSNLEG00000016342   Transcript: ENSNLET00000020828
Sequence length 977
Comment pep:known_by_projection supercontig:Nleu1.0:GL397362.1:3029249:3115922:1 gene:ENSNLEG00000016342 transcript:ENSNLET00000020828 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALFAVFQATFFLTLLSLRTYQSEVLAEHLPLTPVSLKVSTNSTHQSLHLQWTVHNLPYH
QELKMVFQIQISRIETSNVIWVGNYSTTVKWNQVLHWSWESELPLECATHFVRIKSLVDD
AKFPEPNFWSNWSSWEEVSVQDSFGRDILFVFPKDKLVEEGSNVTICYVSKNTENNVSCY
LEGKQIHGEQLDPHVTAFSLNSVPFIRNKGTNVYCEASQGNVSKGIRGIVLFVSKVLEEP
KDFSCETQDFRTLHCTWDPGTDTTLGWSKQPSQSYTLFESFSGEKKLCIHKNWCNWQITQ
DSQETYNFTLVAENYLRKRSVNILFNLTHRVYLMNPFSVNFENVNATNAIMTWKVHSMRN
NFTYLCQIELHGEGKMMQYNVSIKVNGEYFLSELEPATEYRARVRCAGDSHFWKWSEWSG
QNFTTLEAAPSEAPDVWRRVNLEPGNHTVTLFWKPLSKLHANGKILFYNVIVENLDKPSR
SELHSIPAPANSTKLILDRCSYQICVTANNSAGASPPSAIVISADPENKEVEEERIAGTE
SGFFLSWKPQPGDVIGYVVDWCDHTQDVLGDFQWKNVGPNTTSTVISTDAFRPGVRYDFR
IYGLSTKRIACLLERKTGYSQELAPSDNPHVLVDTLTSHSFTLSWKDYSTESQPGFIQGY
HVYLKSQARQCHPRFEKAVLSDGSECCKYKIDNPGEKALTVDNLKPESFYEFFVTPFTSA
GEGPNATFTKVTTPDEHSWMLIRILPPMVFCVLLITVMCYFNSQWIKETCYPDIPDPYES
SILSLIKFKEKPHLTVMNVSDCIPDAIEVVSKPEETKILGTRKSLTETELTKPNYLYLLP
TEKNHSGPGPCICFENLTYNQAASDSGSCGHVPVPPKAPSMLGLMTSPENVLKALEKNYM
NSLGEIPAGETSLNYVSQLASPMSGDKGSLPTNPVEPPHCSGYKTQMAVPLRLALPPPTK
NSSLSSITLLDPGEHYR
Download sequence
Identical sequences G1S2U3
ENSNLEP00000019831 XP_003274412.1.23891 XP_012357145.1.23891 ENSNLEP00000019831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]