SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019864 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019864
Domain Number 1 Region: 13-109
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 9.78e-38
Family Platelet-derived growth factor-like 0.00000264
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019864   Gene: ENSNLEG00000016375   Transcript: ENSNLET00000020862
Sequence length 147
Comment pep:known_by_projection supercontig:Nleu1.0:GL397280.1:12051753:12063007:-1 gene:ENSNLEG00000016375 transcript:ENSNLET00000020862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHIFSPSCVSLLRC
TGCCGDENLHCVPVETANVTMQLLKIRSGDPPSYVEMTFSQHVRCECRPLWEKMKPERRR
PKGRGKRRREKQRPTDCHLCGDPVPRR
Download sequence
Identical sequences ENSNLEP00000019864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]