SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019913 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019913
Domain Number 1 Region: 431-560
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000111
Family Growth factor receptor domain 0.0095
Further Details:      
 
Domain Number 2 Region: 367-409
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000245
Family EGF-type module 0.008
Further Details:      
 
Domain Number 3 Region: 720-846
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000518
Family Growth factor receptor domain 0.0086
Further Details:      
 
Domain Number 4 Region: 618-660
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000309
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 5 Region: 331-370
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000317
Family EGF-type module 0.013
Further Details:      
 
Domain Number 6 Region: 653-693
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000119
Family EGF-type module 0.013
Further Details:      
 
Domain Number 7 Region: 289-333
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000134
Family EGF-type module 0.011
Further Details:      
 
Domain Number 8 Region: 697-731
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000101
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000019913
Domain Number - Region: 583-618
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00042
Family EGF-type module 0.063
Further Details:      
 
Domain Number - Region: 852-908
Classification Level Classification E-value
Superfamily FnI-like domain 0.00251
Family VWC domain 0.051
Further Details:      
 
Domain Number - Region: 407-436
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0597
Family EGF-type module 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019913   Gene: ENSNLEG00000016400   Transcript: ENSNLET00000020912
Sequence length 1220
Comment pep:known_by_projection supercontig:Nleu1.0:GL397390.1:4451441:4476284:-1 gene:ENSNLEG00000016400 transcript:ENSNLET00000020912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAYFAARPMGYFELQLSALRNVNGELLSGACCDGDGRTTRAGGCGHDECDTYVRVCLKEY
QAKVTPTGPCSYGHGATPVLGGNSFYLPPAGAAGDRARARARAGGDQDPGLVVIPFQFAW
PRSFTLIVEAWDWDNDTTPNEELLIERVSHAGMINPEDRWKSLHFSGHVAHLELQIRVRC
DENYYSATCNKFCRPRNDFFGHYTCDQYGNKACMDGWMGKECKEAVCKQGCNLLHGGCTV
PGECRCSYGWQGRFCDECVPYPGCVHGSCVEPWQCNCETNWGGLLCDKDLNYCGSHHPCT
NGGTCINAEPDQYRCTCPDGYSGRNCEKAEHACTSNPCANGGSCHEVPSGFECHCPSGWS
GPTCALDIDECASNPCAAGGTCVDQVDGFECICPEQWVGATCQLDANECEGKPCLNAFSC
KNLIGGYYCDCIPGWKGINCHINVNDCRGQCQHGGTCKDLVNGYQCVCPRGFGGRHCELE
RDECASSPCHSGGLCEDLADGFHCHCPQGFSGPLCEVDVDLCEPSPCRNGARCYNLEGDY
YCACPDDFGGKNCSVPREPCPGGACRVIDGCGSDAGPGMPGTAASGVCGPHGHCVSQPGG
NFSCICDSGFTGTYCHENIDDCLGQPCHNGGTCIDEVDAFRCFCPSGWEGELCDTNPNDC
LPDPCHSRGRCYDLVNDFYCACDDGWKGKTCHSREFQCDAYTCSNGGTCYDSGDTFRCAC
PPGWKGSTCAVAKNSSCLPNPCVNGGTCVGSGASFSCICRDGWEGRTCTHNTNDCNPLPC
YNGGICVDGVNWFRCECAPGFAGPDCRINIDECQSSPCAYGATCVDEINGYRCSCPPGRA
GPRCQEVIGFGRSCWSRGTPFPHGSSWVEDCNSCRCLDGRRDCSKVWCGWKPCLLTGQPE
ALSAQCPPGQRCLEKAPGQCLRPPCEAWGECGAEEPPSTPCLPRSGHLDNNCARLTLRFN
RDHVPQGTTVGAICSGIRSLPATRAVARDRLLVLLCDRASSGASAVEVAVSFSPARDLPD
SSLIQGAAHAIVAAITQWGNSSLLLAVTEVKVETVVMGGSSTGLLVPVLCGAFSVLWLAC
VVLCVWWTRKRRKERERSRLPREESTNNQWAPLNPIRNPIERPGGHKDVLYQCKNFTPPP
RRADEALPGPAGHAGVREDEEDEDLGRGEEDSLEAEKFLSHKFTKDPGRSPGRPAPWASG
LKVDNRAVRSINEARYAGKE
Download sequence
Identical sequences ENSNLEP00000019913 ENSNLEP00000019913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]