SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019929 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019929
Domain Number 1 Region: 579-769,861-1182
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.77e-71
Family Tandem AAA-ATPase domain 0.029
Further Details:      
 
Domain Number 2 Region: 201-255
Classification Level Classification E-value
Superfamily UBA-like 0.00000102
Family UBA domain 0.038
Further Details:      
 
Domain Number 3 Region: 334-358
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000327
Family CCCH zinc finger 0.0034
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000019929
Domain Number - Region: 371-453
Classification Level Classification E-value
Superfamily UBC-like 0.00595
Family UBC-related 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019929   Gene: ENSNLEG00000016369   Transcript: ENSNLET00000020928
Sequence length 1420
Comment pep:known_by_projection supercontig:Nleu1.0:GL397288.1:18663147:18741918:-1 gene:ENSNLEG00000016369 transcript:ENSNLET00000020928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ENREGGQAQFGPLTLGQHLPTAGSGPNSASQVEMSSSVRRKGKPGKGGGKGSSRGGRGGR
SHTSKSHGSGGGGGGGGGGGGGGNRKASSRIWDDGDDFCIFSESRRPSRPSNSNVSKGES
RPKWKPKAKVPLQTLHMTSENQEKVKALLRDLQEQDADAGSERGISGEEEDDEPDCCNDE
RYWPAGQEPSLVPDLDPLEYAGLAPVEPYVPEFTVSPFAVQKLSRYGFNIERCQAVLRMC
DGDVGASLEHLLTQCFSETFGERMKISETVNQISLDECMEQRQEEAFALKSICGEKFIER
IQNRVWTIGLELKYLTSRFRKSKPKESTKTVQENSLEICKFYLKGNCKFGSKCKFKHEVP
PNQIVGRIERSVDDSHLNANEDASFLYELEIRFSKDHKYPYQAPLVAFYSTNENLPLACR
LHISEFLYDKALTFAETSEPVVYSLITLLEEESEIVKLLMNTHHKYSVPPVNFLPVPSRT
RINNPACHKPVIPNNSFVSNQIPEVEKESESEESDEDEGPAPVIVENESYVNLKKKISKR
YDWQAKSVHAENGKICKQFRMKQASRQFQSILQERQSLPAWEERETILNLLRKHQVVVIS
GMTGCGKTTQIPQFILDDSLNGPPEKVANIICTQPRRISAISVAERVAKERVERVGLTVG
YQIRLESVKSSATRLLYCTTGVLLRRLEGDTALQGVSHIIVDEVHERTEESDFLLLVLKD
IVSQRPGLQVILMSATLNAELFSEYFNSCPVITIPGRTFPVDQFFLEDAIAVTRYVLQDG
SPYMRSMKQISKEKLKARRNRTAFEEVEEDLRLSLHLQDQDSVKDAVPDQQLDFKQLLAR
YKGVSKSVIKTMSIMDFEKVNLELIEALLEWIVDGKHSYPPGAILVFLPGLAEIKMLYEQ
LQSNSLFNNRRSNRCVIHPLHSSLSSEEQQAVFVKPPVGVTKIIISTNIAETSITIDDVV
YVIDSGKMKEKRYDASKGMESLEDTFVSQANALQRKGRAGRVASGVCFHLFTSHHYNHQL
LKQQLPEIQRVPLEQLCLRIKILEMFSAHNLQSVFSRLIEPPHNDSLRASKIRLRDLGAL
TPDEKLTPLGYHLASLPVDVRIGKLMLFGSIFRCLDPALTIAASLAFKSPFVSPWDKKEE
ANQKKLEFAFANSDYLALLRAYKGWQLSTKEGMRASYNYCRQNFLSGRVLQEMASLKRQF
TELLSDIGFAREGLRAREIEKRAQGGDGVLDATGEEANSNAENPKLISAMLCAALYPNVV
QVKSPEGKFQKTSTGAVRMQPKSAELKFVTKNDGYVHIHPSSVNYQVRHFDSPYLLYHEK
IKTSRVFIRDCSMVSVYPLVLFGGGQVNVQLQRGEFVVSLDDGWIRFVAASHQVAELVKE
LRCELDQLLQDKIKNPSIDLCTCPRGSRIISTIVKLVTTQ
Download sequence
Identical sequences ENSNLEP00000019929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]