SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019961 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019961
Domain Number 1 Region: 506-584
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000285
Family Canonical RBD 0.016
Further Details:      
 
Domain Number 2 Region: 864-934
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000111
Family Canonical RBD 0.023
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000019961
Domain Number - Region: 266-292
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000103
Family CCCH zinc finger 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019961   Gene: ENSNLEG00000016429   Transcript: ENSNLET00000020960
Sequence length 983
Comment pep:known_by_projection supercontig:Nleu1.0:GL397270.1:27007867:27062768:-1 gene:ENSNLEG00000016429 transcript:ENSNLET00000020960 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CDADPSALAKYVLALVKKDKSEKELKALCIDQLDVFLQKETQIFVEKLFDAVNTKSYLPP
PEQPSSGSLKVEFFPHQEKDIKKEEITKEEEREKKFSRRLNHSPPQSSSRYRENRSRDER
KKDDRSRKRDYDRNPPRRDSYRDRYNRRRGRSRSYSRSRSRSWSKERLRERDRDRSRTRS
RSRTRSRERDLVKPKYDLDRTDPLENNYTPVSSVPSISSGHYPVPTLSSTITVIAPTHHG
NNTTESWSEFHEDQVDHNSYVRPPMPKKRCRDYDEKGFCMRGDMCPFDHGSDPVVVEDVN
LPGMLPFPAQPPVVEGPPPPGLPPPPPILTPPPVNLRPPVPPPGPLPPSLPPVTGPPPPL
PPLQPSGMDAPPNSATSSVPTVVTTGIHHQPPPAPPSLFTADTYDTDGYNPEAPSITNTS
RPMYRHRVHAQRPNLIGLTSGDMDLPPREKPPNKSSMRIVVDSESRKRTIGSGEPGVPTK
KTWFDKPNFNRTNSPGFQKKVQFGNENTKLELRKVPPELNNISKLNEHFSRFGTLVNLQV
AYNGDPEGALIQFATYEEAKKAISSTEAVLNNRFIKVYWHREGSTQQLQTTSPKVMQPLV
QQPILPVVKQSVKERLGPVPSSTIEPAEAQSATSDLPQNVTKLSVKDRLGFVSKPSVSAT
EKVLSTSTGLTKTVYNPAALKAAQKTLLVSTSAVDNNEAQKKKQEALKLQQDVRKRKQEI
LEKHIETQKMLISKLEKNKTMKSEDKAEIMKTLEVLTKNITKLKDEVKAASPGRCLPKSI
KTKTQMQKELLDTELDLYKKMQAGEEVTELRRKYTELQLEAAKRGILSSGRGRGIHSRGR
GAVHGRGRGRGRGRGVPGHAVVDHRPRALEISAFTESDREDLLPHFAQYGEIEDCQIDDS
SLHAVITFKTRAEAEAAAVHGARFKGQDLKLAWNKPVTNISAVETEEVEPDEEEFQEESL
VDDSLLQDDDEEEEDNESRSWRR
Download sequence
Identical sequences ENSNLEP00000019961 ENSNLEP00000019961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]