SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019966 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019966
Domain Number 1 Region: 25-83
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000181
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000019966
Domain Number - Region: 401-472
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0028
Family Fibronectin type III 0.01
Further Details:      
 
Domain Number - Region: 160-225
Classification Level Classification E-value
Superfamily Fibronectin type III 0.064
Family Fibronectin type III 0.0098
Further Details:      
 
Domain Number - Region: 353-419
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0846
Family Fibronectin type III 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019966   Gene: ENSNLEG00000016452   Transcript: ENSNLET00000020966
Sequence length 615
Comment pep:known_by_projection supercontig:Nleu1.0:GL397294.1:5876752:6001561:-1 gene:ENSNLEG00000016452 transcript:ENSNLET00000020966 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGYLPRNGPEPFHPTTDATSCTEIDCGTPPEVPDGYIIGNYTSRLGSQVRYACREGFFS
VPEDTVSSCTALGTWESPKLHCQGEKDFSTSSCPHGILTPLHFQMARAGVWVLQQGSPRI
GGKTWNLSFPSKSGNGPRSFMMKTKILTKINDVSVFNDTCVRWQINSGRINPKISYVISI
KGQRLDPMESVHEETVNLTTDSRTPEVCLSLYPGTNYTVNISTAPPRRSVPAVIGFQTVE
DDLLEDDGRFNISIFNETCLKLNRHSRKVGSEHTYQFTVLGQRWYLANFSHATSFNFTTR
EQVPVVCLDLYPTTDYTVNVTLLRSPKWHSVQITIATPPAVKQTISNISGFNETCLRWRS
IKTADMEEMYLFHIWGQRWYQKEFAQEMTFNISSSSRDPEVCLDLRPGTNYNVSLRALSS
ELPVVISLTTQITEPPLPEVEFFTVHGGPLPRLRLRKAKEKNGPISSYQVLVLPLALQST
FSCDSEGASSFFSNASDADGYVAAELLAKDVPDDAMEIPIGDRLYYGEYYNAPLKRGSDY
CIILRITSEWNKVRRHSCAVWAQVKEIPCNCNFLRLHIHRANSGDTQACWAFLGFFIRHS
RCCRWRVLDWAPWLL
Download sequence
Identical sequences ENSNLEP00000019966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]