SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019971 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019971
Domain Number 1 Region: 176-324
Classification Level Classification E-value
Superfamily EF-hand 9.81e-53
Family Osteonectin 0.0000000717
Further Details:      
 
Domain Number 2 Region: 118-173
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000166
Family Ovomucoid domain III-like 0.0000355
Further Details:      
 
Domain Number 3 Region: 93-117
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000188
Family Follistatin (FS) module N-terminal domain, FS-N 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019971   Gene: ENSNLEG00000016420   Transcript: ENSNLET00000020971
Sequence length 326
Comment pep:known_by_projection supercontig:Nleu1.0:GL397398.1:63519:90062:-1 gene:ENSNLEG00000016420 transcript:ENSNLET00000020971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSDCPESALCLPPACLPLRVPSTMRAWIFFLLCLAGRALAAPQQEALPDETEVVEETVAE
VTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQD
PTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLD
SELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLA
RDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDN
DKYIALDEWAGCFGIKQKDIDKDLVI
Download sequence
Identical sequences ENSNLEP00000019971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]