SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020009 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020009
Domain Number 1 Region: 179-227
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000647
Family EGF-type module 0.017
Further Details:      
 
Domain Number 2 Region: 220-268
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000184
Family EGF-type module 0.017
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000020009
Domain Number - Region: 144-189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000293
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020009   Gene: ENSNLEG00000016468   Transcript: ENSNLET00000021012
Sequence length 545
Comment pep:known_by_projection supercontig:Nleu1.0:GL397335.1:7191265:7230141:1 gene:ENSNLEG00000016468 transcript:ENSNLET00000021012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPFLLLTCLFITGTSVSPVALDPCSAYISLNEPWRNTDHQLDESQGPPLCDNHVNGEWY
HFTGMAGDAMPTFCIPENHCGTHAPVWLNGSHPLEGDGIVQRQACASFNGNCCLWNTTVE
VKACPGGYYVYRLTKPSVCFHVYCGHFYDICDEDCHGSCSDTSECTCAPGTVLGPDRQTC
FDENECEQNNGGCSEICVNLKNSYRCECGVGRVLRSDGKTCEDIEGCHNNNGGCSHSCLG
SEKGYQCECPRGLVLSEDNHTCQVPVLCKSNAIEVSIPRELVGGLELFLTNTSCRGVSNG
THVNILFSLKTCGTVVDVVNDKIVASNLVTGLPKQTPGSSGDFIIRTSKLLIPVTCEFPR
LYTISEGYVPNLRNSPLEIMSRNHGIFPFTLEIFKDNEFEEPYREALPTLKLRDSLYFGI
EPLVHVSGLESLVESCFATPTSKIDEVLKYYLIQDGCVSDDSVKQYTSRDHLAKHFQVPV
FKFVGKDHKEVFLHCRVLVCGVLDERSRCAQGCHRRMRRGAGGEDSAGLQSQTLTGGPIR
IDWED
Download sequence
Identical sequences G1S3C1
ENSNLEP00000020009 ENSNLEP00000020009 XP_003271284.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]