SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020027 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020027
Domain Number 1 Region: 4-95
Classification Level Classification E-value
Superfamily DEATH domain 1.7e-19
Family Caspase recruitment domain, CARD 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020027   Gene: ENSNLEG00000016512   Transcript: ENSNLET00000021031
Sequence length 1038
Comment pep:known_by_projection supercontig:Nleu1.0:GL397362.1:5044622:5058790:1 gene:ENSNLEG00000016512 transcript:ENSNLET00000021031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATESTPSEIIERERKKLLEILQHDPDSILDTLTSRRLISEEEYETLENVTDLLKKSRKL
LILVQKKGEATCQHFLKCLFSTFPQSAAICGLRHEVLKHENIVPPQSMGASNNSEDAFSP
GIKQPEAPEITVFFSEKEHLDLETSEFFRDKKTSYKETALSAKKNEKEYDTPEVTLSYSV
EKAGYEVPATITYIKDGQRYEELDDSLYLGKEEYLGSVDSPEDAEATVEEEVYDDPEHVG
YDGEEDFENSETTEFSGEEPSYEESETNLSLEEEQEKSIEERKKVFKDVLLCLNMDRSRK
VLPDFVKQFSVDRGCKWTPESPGDLAWNFLMKVQALDVTARDSILRHKVLDEDSKEDLLP
GVENLEIRDIQTINPLDVLCAAMLCSDSSLQRQVMSNMYQCQFALPLLLPDAENNKSILM
LGAMKDIVKKQSTQFSGGPTEDTENFLTLMKMPVISFVRLGYCSFSKSRILNALLSPAQL
KLHKIFLHQDLPLLVLPRQISDGLVEITWCFPDSDDRKENPCFFQKPVALANLRGNLESF
WTQFGFLMEVSSAVFFFTDCLGEKEWDLLMFLGEAAIERCYFVLSSQARESEEAQIFQRI
LNLKPAQLLFWEQGDAGDRRKNMEGLQAALQEVMFSSCLRCVSVEDMAALARELGIQVDE
DFENTHRIQVSSGENMAGTAEGEGQQRHSQLKSSSKSQALMPIREPGTQCERSQNVQNLY
GTPVFRPLLENSWLFPTRVGGNFNHVSLKAPWVMGRPFGSQQRPKWFCPLPLQNARAQGR
GKSFGIQSFHPQIFYSGERFMKFSRAAQGCHSNGTFGRLPRPICQHVQACPERPQMMGTL
EKSRAVASQIGHSYSLDSQPARAVGKPWPQQACTRGTELTEATGKLIRTSHIGKPHPQSF
QPAGATQKLRPDSQQGTQMKTQGRASNPALQIGSHPMSKSSQFKSDQSNPSTVKHSQPKP
FHSVPSQSKPSQTKSCQSKPSQTKPSPCKSTQPKPSQPQPPQSKPSQPRPTQPKSSSTNP
SQAKAHHSKAGPKRGGKH
Download sequence
Identical sequences G1S3D9
ENSNLEP00000020027 XP_003274424.1.23891 ENSNLEP00000020027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]