SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020061 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020061
Domain Number 1 Region: 31-93
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000431
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000020061
Domain Number - Region: 87-145
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0623
Family Rhodopsin-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020061   Gene: ENSNLEG00000016539   Transcript: ENSNLET00000021067
Sequence length 255
Comment pep:known_by_projection supercontig:Nleu1.0:GL397279.1:885187:918515:1 gene:ENSNLEG00000016539 transcript:ENSNLET00000021067 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGAAATLRGKARPRGRAGVTTPAPGNRTGTCAKLRLPLQATFQVLRGDGASVGTVLMFR
CPSNHQMVGSGLLTCTWKGSIAEWSSGSPVCKLVPPHETFGFKVAVIASIVSCAIILLMS
MAFLTCCLLKCVKKSEQRHSNRSAQLWSQLKDEDLETVQAAYLGLKHFNKPVSGPSQAHD
NHSFTTDHGESTSKLASVTRSVDKDPGIPRALSLSGSSSSPQAQVMVHMVNPRQPLLASG
LATGMPQQPAAYALG
Download sequence
Identical sequences G1S3H3
ENSNLEP00000020061 XP_003260549.1.23891 ENSNLEP00000020061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]