SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020092 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020092
Domain Number 1 Region: 5-211
Classification Level Classification E-value
Superfamily L domain-like 4.35e-32
Family Ngr ectodomain-like 0.012
Further Details:      
 
Domain Number 2 Region: 208-307
Classification Level Classification E-value
Superfamily Immunoglobulin 4.75e-16
Family I set domains 0.011
Further Details:      
 
Domain Number 3 Region: 443-510
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000162
Family Fibronectin type III 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020092   Gene: ENSNLEG00000016566   Transcript: ENSNLET00000021098
Sequence length 634
Comment pep:known_by_projection supercontig:Nleu1.0:GL397323.1:6301426:6328735:-1 gene:ENSNLEG00000016566 transcript:ENSNLET00000021098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDMNELPTNLPVDTVKLRIEKTVIRRISAEAFYYLVELQYLWVTYNSVASIDVSSFYNLK
QLHELRLDGNSLAAFPWASLLDMPLLRTLDLHNNKLTSVPNEALRYLKNLAYLDLSSNRL
TTLPPDFLESWSHLVTTPSGVLDLSPSRIILGLQDNPWFCDCHISKMIELSKVVDPAIVL
LDPLMTCSEPERLTGILFQRAELERCLKPSVMTSATKIMSALGSNVLLRCDATGFPTPQL
TWTRSDSSPVNYTVIQESPEEGVRWSIMSLTGISSKDAGDYKCKAKNLAGVSEAVVTLTV
LGITTTPIPPDTSERTGDHPEWDVQPGPGRSTSVSSASSYPWSSSFSPTSSFSASTLPPP
STASFSLSPFFSSTVSSNTTLSTSISANTTMANKRSFQLHPGGKINLKVAKNGSKLPPAS
TSKKEELALLDQTMLTETNATIENLRVVSETKESVTLTWNMINTTHNSAVTVLYSKYGGK
DLLLLNADSSKNQVTIDGLEPGGQYMACVCPKGVPPQKDQCITFSTERVEGDDSQWSLLL
VVTSTACVVILPLICFLLYKVCKLQCKSEPFWEDDLAKETYIQFETLFPRSQSVGELWTR
THRDDSEKLLLCSRSSVESQVTFKSEGSRPEYYC
Download sequence
Identical sequences ENSNLEP00000020092 ENSNLEP00000020092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]