SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020104 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020104
Domain Number 1 Region: 72-393
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 5.19e-65
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000000403
Further Details:      
 
Domain Number 2 Region: 400-539
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.66e-33
Family Ricin B-like 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020104   Gene: ENSNLEG00000016565   Transcript: ENSNLET00000021110
Sequence length 551
Comment pep:known_by_projection supercontig:Nleu1.0:GL397398.1:2704570:2830849:1 gene:ENSNLEG00000016565 transcript:ENSNLET00000021110 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KGSHSRQKKTFFLGDGQKLKDWHDKEAIQRDAQHVGNGEQGRPYPMTDAERVDQAYRENG
FNIYVSDKISLNRSLPDIRHPNCNSKRYLETLPNTSIIIPFHNEGWSSLLRTVHSVLNRS
PPELVAEIVLVDDFSDREHLKKPLEDYMALFPSVRILRTKKREGLIRTRMLGASVATGDV
ITFLDSHCEANVNWLPPLLDRIARNRKTIVCPMIDVIDHDDFRYETQAGDAMRGAFDWEM
YYKRIPIPPELQKADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFK
VWMCGGRMEDIPCSRVGHIYRKYVPYKVPAGVSLARNLKRVAEVWMDEYAEYIYQRRPEY
RHLSAGDVAVQKKLRSSLNCKSFKWFMTKIAWDLPKFYPPVEPPAAAWGEIRNVGTGLCA
DTKHGALGSPLRLEGCVRGRGEAAWNNMQVFTFTWREDIRPGDPQHTKKFCFDAISHTSP
VTLYDCHSMKGNQLWKYRKDKTLYHPVSGSCMDCSESDHRIFMNTCNPSSLTQQWLFEHT
NSTVLEKFNRN
Download sequence
Identical sequences ENSNLEP00000020104 ENSNLEP00000020104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]