SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020117 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020117
Domain Number 1 Region: 323-573
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.23e-68
Family Eukaryotic proteases 0.0018
Further Details:      
 
Domain Number 2 Region: 110-218
Classification Level Classification E-value
Superfamily SRCR-like 2.09e-18
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0078
Further Details:      
 
Domain Number 3 Region: 258-296
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000432
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 4 Region: 223-256
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000327
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 5 Region: 46-106
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000656
Family Ovomucoid domain III-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020117   Gene: ENSNLEG00000016589   Transcript: ENSNLET00000021123
Sequence length 582
Comment pep:known_by_projection supercontig:Nleu1.0:GL397323.1:6377279:6447928:1 gene:ENSNLEG00000016589 transcript:ENSNLET00000021123 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLLHVFLLFLSFHLSFCKVTYTSQEDLVEKKCLAKKYTHLSCNKVFCQPWQRCIEGTCI
CKLPYQCPKNGTAVCATNGRSFPTYCQQKSLECLRPGTKFLNNGTCTAEGKFSVSLKHGN
TDSEGIVEVKLVDQDKTTFICKSSWSMREANVACFDLGFQQGADTQRRFKLSDLSINSTE
CLHVHCRGIETSLAECTFTKRRTMGYQDLADVVCYTQKADSPTNDFFQCVNGKYISQMKA
CDGINDCGDQSDELCCKACQGKSFHCKSGVCIPSQYRCNGEVDCITGEDEVGCEGFASVA
QDNNDVISSFLEERRRIKSLLPKLSCGVKNRTHIRRKRIVGGKRAQLGDLPWQVGIKDAS
GITCGGIYIGGCWILTAAHCLRASKTHRYQIWTTVVDWIHPDRKRIVVEYVDRIIFHENY
NAGTYQNDIALIEMKKDGNKKDCELPRSIPACVPWSPYLFQPNDTCIVSGWGREKDNEKV
FSLQWGEVKLISNCSKFYGNRFYEKEMECAGTYDGSIDACKGDSGGPLVCMDANNVTYVW
GVVSWGENCGKPEFPGVYTKVANYFDWISYHVGRPFISQYNV
Download sequence
Identical sequences XP_003269405.1.23891 ENSNLEP00000020117 ENSNLEP00000020117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]