SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020184 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020184
Domain Number 1 Region: 1076-1415
Classification Level Classification E-value
Superfamily NHL repeat 1.49e-23
Family NHL repeat 0.0015
Further Details:      
 
Domain Number 2 Region: 1426-1547
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.00000275
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.032
Further Details:      
 
Domain Number 3 Region: 771-842
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000051
Family Pre-dockerin domain 0.069
Further Details:      
 
Domain Number 4 Region: 480-505
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000388
Family EGF-type module 0.044
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000020184
Domain Number - Region: 610-635
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000213
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 513-539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000381
Family EGF-type module 0.054
Further Details:      
 
Domain Number - Region: 580-604
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000838
Family EGF-type module 0.042
Further Details:      
 
Domain Number - Region: 646-681
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00145
Family EGF-type module 0.046
Further Details:      
 
Domain Number - Region: 446-473
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00442
Family Integrin beta EGF-like domains 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020184   Gene: ENSNLEG00000016615   Transcript: ENSNLET00000021193
Sequence length 2616
Comment pep:known_by_projection supercontig:Nleu1.0:GL397264.1:11267886:11509433:1 gene:ENSNLEG00000016615 transcript:ENSNLET00000021193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTAADRSVCALDHPGGLQNHARLRTPPPPLSHAHTPNQHHAASINSLNRGNFTPRSNPSP
APTDHSLSGEPPAGGAQEPAHAQDNWLLNSNIPLETRNLGKQPFLGTLQDNLIEMDILGA
SRHDGAYGDGHFLFKPGGTSPLFCTTSPGYPLTSSTVYSPPPRPLPRSTFARPAFNLKKP
SKYCNWKCAALSAIVISATLVILLAYFVAMHLFGLNWHLQPMEGQMYEITEDTASSWPVP
TDVSLYPSGGTGLETPDRKGKGTTEGKPSSFFPEDSFIDSGEIDVGRRASQKIPPGTFWR
SQVFIDHPVHLKFNVSLGKAALVGIYGRKGLPPSHTQFDFVELLDGRRLLTQEARSLEGT
PRQSRGAVPPSSHETGFIQYLDSGIWHLAFYNDGKESEVVSFLTTAIESVDNCPSNCYGN
GDCISGTCHCFLGFLGPDCGRASCPVLCSGNGQYMKGRCLCHSGWKGAECDVPTNQCIDV
ACSNHGTCIMGTCICNPGYKGESCEEVDCMDPTCSGRGVCVRGECHCSVGWGGTNCETPR
ATCLDQCSGHGTFLPDTGLCSCDPSWTGHDCSIEICAADCGGHGVCVGGTCRCEDGWMGA
ACDQRACHPRCAEHGTCRDGKCECSPGWNGEHCTIAHYLDRVVKEGCPGLCNGNGRCTLD
LNGWHCVCQLGWRGAGCDTSMETACGDSKDNDGDGLVDCMDPDCCLQPLCHVNPLCLGSP
DPLDIIQETQVPVSQQNLHSFYDRIKFLVGRDSTHIIPGENPFDGGHACVIRGQVMTSDG
TPLVGVNISFVNNPLFGYTISRQDGSFDLVTNGGISIILRFERAPFITQEHTLWLPWDRF
FVMETIIMRHEENEIPSCDLSNFARPNPVVSPSPLTSFASSCAEKGPIVPEIQALQEEIS
ISGCKMRLSYLSSRTPGYKSVLRISLTHPTIPFNLMKVHLMVAVEGRLFRKWFAAAPDLS
YYFIWDKADVYNQKVFGLSEAFVSVGYEYESCPDLILWEKRTAVLQGYEIDASKLGGWSL
DKHHALNIQSGILHKGNGENQFVSQQPPVIGSIMGNGRRRSISCPSCNGLADGNKLLAPV
ALTCGSDGSLYVGDFNYIRRIFPSGNVTNILELRNKDFRHSHSPAHKYYLTTDPMSGAVY
LSDTNSRRVFKIKSTVVVKDLVKNSEVVAGTGDQCLPFDDTRCGDGGKATEATLTNPRGI
TVDKFGLIYFVDGTMIRRIDQNGIISTLLGSNDLTSARPLSCDSVMDISQVRLEWPTDLA
INPMDNSLYVLDNNVVLQISENHQVRIVAGRPMHCQVPGIDHFLLSKVAIHATLESATAL
AVSHNGVLYIAETDEKKINRIRQVTTSGEISLVAGAPSGCDCKNDANCDCFSGDDGYAKD
AKLNTPSSLAVCADGELYVADLGNIRIRFIRKNKPFLNTQNMYELSSPIDQELYLFDTTG
KHLYTQSLPTGDYLYNFTYTGDGDITLITDNNGNMVNVRRDSTGMPLWLVVPDGQVYWVT
MGTNSALKSVTTQGHELAMMTYHGNSGLLATKSNENGWTTFYEYDSFGRLTNVTFPTGQV
SSFRSDTDSSVHVQVETSSKDDVTITTNLSASGAFYTLLQDQVRNSYYIGADGSLRLLLA
NGMEVALQTEPHLLAGTVNPTVGKRNVTLPIDNGLNLVEWRQRKEQARGQVTVFGRRLRV
HNRNLLSLDFDRVTRTEKIYDDHRKFTLRILYDQAGRPSLWSPSSRLNGVNVTYSPGGHI
AGIQRGIMSERMEYDQAGRITSRIFADGKTWSYTYLEKSMVLLLHSQRQYIFEFDKNDRL
SSVTMPNVARQTLETIRSVGYYRNIYQPPEGNASVIQDFTEDGHLLHTFYLGTGRRVIYK
YGKLSKLAETLYDTTKVSFTYDETAGMLKTINLQNEGFTCTIRYRQIGPLIDRQIFRFTE
EGMVNARFDYNYDNSFRVTSMQAVINETPLPIDLYRYDDVSGKTEQFGKFGVIYYDINQI
ITTAVMTHTKHFDAYGRMKEVQYEIFRSLMYWMTVQYDNMGRVVKKELKVGPYANTTRYS
YEYDADGQLQTVSINDKPLWRYSYDLNGNLHLLSPGNSARLTPLRYDIRDRITRLGDVQY
KMDEDGFLRQRGGDIFEYNSAGLLIKAYNRAGGWSVRYRYDGLGRRVSSKSSHSHHLQFF
YADLTNPTKVTHLYNHSSSEITSLYYDLQGHLFAMELSSGDEFYIACDNIGTPLAVFSGT
GLMIKQILYTAYGEIYMDTNPNFQIIIGYHGGLYDPLTKLVHMGRRDYDVLAGRWTSPDH
ELWKHLSSSNIMPFNLYMFKNNNPISNSQDIKCFMTDVNSWLLTFGFQLHNVIPGYPKPD
MDAMEPSYELIHTQMKTQEWDNNKSILGVQCEVQKQLKAFVTLERFDQLYGSTITSCQQA
PKTKKFASSGSVFGKGVKFALKDGRVTTDIISVANEDGRRVAAILNNAHYLENLHFTIDG
VDTHYFVKPGPSEGDLAILGLSGGRRTLENGVNVTVSQINTVLNGRTRRYTDIQLQYGAL
CLNTRYGTTLDEEKARVLELARQRAVRQAWAREQQRLREGEEGLRAWTEGEKQQVLSTGQ
VQGYDGFFVISVEQYPELSDSANNIHFMRQSEMGRR
Download sequence
Identical sequences ENSNLEP00000020184 ENSNLEP00000020184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]