SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020220 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020220
Domain Number 1 Region: 10-66
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000087
Family RING finger domain, C3HC4 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020220   Gene: ENSNLEG00000016668   Transcript: ENSNLET00000021230
Sequence length 192
Comment pep:known_by_projection supercontig:Nleu1.0:GL397294.1:7122340:7124286:-1 gene:ENSNLEG00000016668 transcript:ENSNLET00000021230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEQQGQELEAECPVCWNPFNNTFHTPKMLDCCHSFCVECLAHLSLVTPARRRLLCPLCR
QPTVLASGQPVTDLPTDTAMLTLLRLEPHHVILEGHQLCLKDQPKSRYFLRQPRVYTLDL
GPQAGGQTGPPPDTASATVPTPIPIPSHYSLRECFRNPQFRIFAYLMAVIFSVTLLLIFS
IFWTKQFLRGVG
Download sequence
Identical sequences A0A2I3HT30
ENSNLEP00000020220 ENSNLEP00000020220 XP_003264067.1.23891 XP_004088851.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]