SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020239 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020239
Domain Number 1 Region: 50-148
Classification Level Classification E-value
Superfamily Fibronectin type III 4.91e-34
Family Fibronectin type III 0.00000126
Further Details:      
 
Domain Number 2 Region: 149-253
Classification Level Classification E-value
Superfamily Fibronectin type III 2.98e-19
Family Fibronectin type III 0.00000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020239   Gene: ENSNLEG00000016678   Transcript: ENSNLET00000021249
Sequence length 638
Comment pep:known_by_projection supercontig:Nleu1.0:GL397362.1:6571986:6876210:1 gene:ENSNLEG00000016678 transcript:ENSNLET00000021249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLWQLLLTLALAGSSDAFSGSEATAAILSRESWSLQSVNPGLKTNSSKEPKFTKCRSPE
RETFSCHWTDAVLHGSKSLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTS
IWIPYCIKLTSNGGTMDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPPN
ADIQKGWMVLEYELQYKEVNETKWKMMDPILSTSVPVYSLKVDKEYEVRVRSKQRNSGNY
GEFSEVLYVTLPPMSQFTCEEDFYFPWLLIIIFGIFGLTVMLFVFLFSKQQRIKMLILPP
VPVPKIKGIDPDLLKEGKLEEVNTILAIHDSYKPEFHSDDSWVEFIELDIDEPDEKTEGS
DTDRLLSSDHEKSHSNLGVKDGDSGRTSCCEPDILETDFNANDIHEGTSEVAQPQRLKGE
ADLLCLDQKNQNNSPYHDACPATQQPSVNQAEKNKPQPLPTEGAESTHQAAHIQLSNPSS
LANIDFYAQVSDITPAGSVVLSPGQKNKAGMSQCDMHLEMVSLCQENFIMDNAYFCEADV
KKCIPVAPHIKVESHVEPSFNQEDIYITTESLTTTAGRPGTAEHVPGSEMPVPDYTSIHI
VQSPQGLILNATALPLPDKEFLSSCGYVSTDQLNKIMP
Download sequence
Identical sequences G1S401
ENSNLEP00000020239 ENSNLEP00000020239 XP_004088258.1.23891 XP_004088259.1.23891 XP_004088260.1.23891 XP_004088261.1.23891 XP_004088262.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]