SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020249 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020249
Domain Number 1 Region: 143-386
Classification Level Classification E-value
Superfamily vWA-like 2.18e-77
Family Integrin A (or I) domain 0.000000549
Further Details:      
 
Domain Number 2 Region: 387-473
Classification Level Classification E-value
Superfamily Integrin domains 6.8e-21
Family Integrin domains 0.0016
Further Details:      
 
Domain Number 3 Region: 44-102
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000549
Family Plexin repeat 0.00072
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000020249
Domain Number - Region: 547-575
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000502
Family Integrin beta EGF-like domains 0.033
Further Details:      
 
Domain Number - Region: 510-547
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00131
Family Integrin beta EGF-like domains 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020249   Gene: ENSNLEG00000016686   Transcript: ENSNLET00000021259
Sequence length 581
Comment pep:known_by_projection supercontig:Nleu1.0:GL397261.1:42982113:43057719:1 gene:ENSNLEG00000016686 transcript:ENSNLET00000021259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCGSALAFFTAAFICLQNDRRGPASFLWAAWVFSLVLGLGQGEDNRCASSNAASCARCLA
LGPECGWCVQEDFISGGSRSERCDIVSNLISKGCSVDSIEYPSVHVIIPTENEINTQVTP
GEVSIQLRPGAEANFMLKVHPLKKYPVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAFF
SRDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFEKA
VHRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIV
VPNDGNCHLKNNVYVKSTTMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPG
TIAGEIESKAANLNNLVVEAYQKLISEVKVQLENQVQGVYFNITAICPDGSRKPGTEGCR
NVTSNDEVLFNVTVTMKKCDVTGGKNYAIIKPIGFNETAKIHIHRNCSCQCEDNRGPKGK
CVDETFLDSKCFQCDENKCHFDEDQFSSESCKSHKDQPVCSGRGVCVCGKCSCHKIKLGK
VYGKYCEKDDFSCPYHHGNLCAGHGECEAGRCQCFMAGKEI
Download sequence
Identical sequences ENSNLEP00000020249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]