SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020283 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020283
Domain Number 1 Region: 187-223
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000000235
Family CCCH zinc finger 0.00017
Further Details:      
 
Domain Number 2 Region: 150-185
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000000445
Family CCCH zinc finger 0.00024
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000020283
Domain Number - Region: 369-447
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0471
Family beta-sandwich domain of Sec23/24 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020283   Gene: ENSNLEG00000016712   Transcript: ENSNLET00000021296
Sequence length 494
Comment pep:known_by_projection supercontig:Nleu1.0:GL397288.1:23266709:23269384:-1 gene:ENSNLEG00000016712 transcript:ENSNLET00000021296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTTLLSAFYDVDFLCKTEKSLANLNLNNMLDKKAVGTPVAAAPSSGFAPGFLRRHSASN
LHALAHAAPSPGSCSPKFPGAANGSSCGSAAAGGPTSYGTLKEPSGGGGTALLNKENKFR
DRSFSDNGDRSQHLLHLQQQQKGGVGSQINSTRYKTELCRPFEESGMCKYGEKCQFAHGF
HELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNADERRPAPSGGASGDLRAFGTRD
ALHLGFPREPRPKLHHSLSFSGFPSGHHQPPGGLESPLLLDSPTSRTPPPPSCSSASSCS
SSASSCSSASAASTPSGAPTCCASAAAAAAAALLYGAGAEDPLAPGAPCAACSSASCAAN
AFAFGPELSSLITPLAIQTHNFAAVAAAAYYRSQQQQQQQQGLAPTAQPPAPPSATLPAG
AAAPPSPPFSFQLPRRLSDSPVFDAPPSPPDSLSDRDSYLSGSLSSGSLSGSESPSLDPG
RRLPIFSRLSISDD
Download sequence
Identical sequences ENSNLEP00000020283 ENSNLEP00000020283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]