SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020325 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020325
Domain Number 1 Region: 399-498
Classification Level Classification E-value
Superfamily BAG domain 1.44e-27
Family BAG domain 0.0000029
Further Details:      
 
Domain Number 2 Region: 19-55
Classification Level Classification E-value
Superfamily WW domain 0.0000000000241
Family WW domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020325   Gene: ENSNLEG00000016750   Transcript: ENSNLET00000021340
Sequence length 574
Comment pep:known_by_projection supercontig:Nleu1.0:GL397265.1:53841739:53867780:1 gene:ENSNLEG00000016750 transcript:ENSNLET00000021340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAATHSPMMQVASGNGDRDPLPPGWEIKIDPQTGWPFFVDHNSRTTTWNDPRVPSEGPK
ETPSSANGPSREGSRLPPAREGHPVYPQLRPGYIPIPVLHEGAENRQAHPFHAYPQPGMQ
RFRTEAAAVAPQRSQSPLRGMPETTQPDKQCGQVAAAAAAQPPASHGPERSQSPAASDCS
SSSSSASLPSSGRSSLGSHQLPRGYISIPVIHEQNVTRPAAQPSPQAQKTHYPAQQGEYQ
THQPVYHKIQGDDWEPRPLSGGIPIQVICQGASSREGSPARSSTPLHSPSPIRVHTVVDR
PQQPMTHRETAPVPQPENKPESKPGPVVPELPPGHVPIQVIRKEADSKPVSQKPPPPSEK
VEVKVPPAPVPCPSPSPGPSAVPSSPKNVATEERAAPSTAPAEATPPKPGEAEAPPKHPG
VLKVEAILEKVQGLEQAVDNFEGKKTDKKYLMIEEYLTKELLALDSVDPEGRADVRQARR
DGVRKVQTILEKLEQKAIDVPGQVQVYELQPSNLEADQPLQAIMEMGAVAADKGKKNAGN
AEDPHAETQQPEATAAATSNPSSTTDTPGNPTAL
Download sequence
Identical sequences G1S487
XP_003255077.1.23891 ENSNLEP00000020325 ENSNLEP00000020325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]