SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020327 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020327
Domain Number 1 Region: 4-135
Classification Level Classification E-value
Superfamily L domain-like 8.84e-35
Family Ngr ectodomain-like 0.0049
Further Details:      
 
Domain Number 2 Region: 226-343
Classification Level Classification E-value
Superfamily Hormone receptor domain 8.5e-17
Family Hormone receptor domain 0.0054
Further Details:      
 
Domain Number 3 Region: 156-259
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000274
Family I set domains 0.022
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000020327
Domain Number - Region: 678-765,838-854
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00785
Family Voltage-gated potassium channels 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020327   Gene: ENSNLEG00000016741   Transcript: ENSNLET00000021342
Sequence length 1237
Comment pep:known_by_projection supercontig:Nleu1.0:GL397274.1:14527112:14662965:-1 gene:ENSNLEG00000016741 transcript:ENSNLET00000021342 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRILSNNKISELKNGSFSGLSLLERLDLRNNLISSIDPGAFWGLSSLKRLDLTNNRIGCL
NADIFRGLTNLVRLNLSGNLFSSLSQGTFEYLASLRSLEFQTEYLLCDCNILWMHRWVKE
RNITVRDTRCVYPKSLQAQPVTGVKQELLTCDPPLELPSFYMTPSHRQVVFEGDSLPFQC
MASYIDQDMQVLWYQDGRIVETDESQGIFVEKNMIHNCSLIASALTISNIQAGSTGNWGC
HVQTKRGNNTRTVDIVVLESSAQYCPPERVVNNKGDFRWPRTLAGITAYLQCTRNTHGSG
IYPGNPQDERKAWRRCDRGGFWADDDYSRCQYANDVTRVLYMFNQMPLNLTNAVATARQL
LAYTVEAANFSDKMDVIFVAEMIEKFGRFTKEEKSKELGDVMVDIASNIMLADERVLWLA
QREAKACSRIVQCLQRIATYRLAGGAHVYSTYSPNIALEAYVIKSTGFTGMTCTVFQKVA
ASDRTGLSDYGRRDPDGNLDKQLSFKCNVSNTFSSLALKNTIVEASIQLPPSLFSPKQKR
ELRPTDDSLYKLQLIAFRNGKLFPATGNSTNLADDGKRRTVVTPVILTKIDGVNVDTHHI
PVNVTLRRIAHGADAVAARWDFDLLNGQGGWKSDGCHILYSDENITTIQCYSLSNYAVLM
DLTGSELYTQAASLLHPVVYTTAIILLLCLLAVIVSYIYHHSLIRISLKSWHMLVNLCFH
IFLTCVVFVGGITQTRNASVCQAVGIILHYSTLATVLWVGVTARNIYKQVTKKAKRCQDP
DEPPPPPRPMLRFYLIGGGIPIIVCGITAAANIKNYGSRPNAPYCWMAWEPSLGAFYGPA
SFITFVNCMYFLSIFIQLKRHPERKYELKEPTEEQQRLAANENGEINHQDSMSLSLISTS
ALENEHTFHSQLLGASLTLLLYVALWMFGALAVSLYYPLDLVFSFIFGATCLSFSAFFMV
HHCVNREDVRLAWIMTCCPGRSSYSVQVNVQPPNSSGTNGEAPKCPNSSAESSCTNKSAS
SFKNSSQGCKLTNLQAAAAQCHANSLPLNSTPQLDNSLTEHSMDNDIKMHVAPLEVQFRT
NVHSSRHHKNRSKGHRASRLTVLREYAYDVPTSVEGSVQNGLPKSRLGNNEGHSRSRRTY
LAYRERQYNPPQQDSSDACSTLPKSSRNFEKPVSTSSKKDALRKPAVVELENQQKSYGLN
LAIQNGPIKSNGQEGPLLGTDSTGNVRTGLWKHETTV
Download sequence
Identical sequences ENSNLEP00000020327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]