SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020345 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000020345
Domain Number - Region: 316-409
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.022
Family Growth factor receptor domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020345   Gene: ENSNLEG00000016759   Transcript: ENSNLET00000021361
Sequence length 1214
Comment pep:known_by_projection supercontig:Nleu1.0:GL397323.1:8410615:8824841:1 gene:ENSNLEG00000016759 transcript:ENSNLET00000021361 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAMAYPLLLCLLLAQLGLGAGASRDPQGRPDSPRERTPRGKPHAQQPARASASDSSAPW
SRSTDGTILAQKLAEEVPMDVASYLYTGDSHQLKRANCSGRYELAGLPGKWPALASAHPS
LHGALDILTHATNFLNVMLQSNKSREQNLQDDLDWYQALVRSLLVGEPSISRAAITFSTE
SLSAPAPQVFLQATREESRILLQDLSSSAPHLANATLETEWFHGLRRRWRSHLHRRGPNQ
GPRGLGHSWRRKDGLGGDKSHVKWSPPYLECENGSYKPGWLVTLSSALYGWQPNLVPEFR
GAMKVDINVQKVDIDQCSSDGWFSGTHKCHLNNSECMPIKGLGFVLGAYECICKAGFYHP
GVLPVNNFRRRGPDQHISGSAKDVSEEAYVCLPCREGCPFCADDSPCFVQEDKYLRLAII
SFQALCMLLDFISMLVVYHFRKAKSIRASGLILLETILFGSLLLYFPVVILYFEPSTFRC
ILLRWVRLLGFATVYGTVTLKLHRVLKVFLSRTAQRIPYMTGGRVMRMLAVILLVVFWFL
IGWTSSVCQNLEKQISLIGQGHTSDHLIFNMCLTDRWDYMTAVAESLFLLWGVYLCYAVR
TVPSAFHEPRYMAVAVHNELIISAIFHTIRFVLASRLQSDWMLMLYFAHTHLTVTVTIGL
LLIPKFSHSSNNPRDDIATEAYEDELDMGRSGSYLNSSINSAWSEHSLDPEDIRDELKKL
YAQLEIYKRKKMITNNPHLQKKRCSKKGLGRSIMRRITEIPETVSRQCSKEDKEGADHGT
AKGTALIRKNPPESSGNTGKSKEETLKNRVFSLKKSHSTYDHVRDQTEESSSLPTESQEE
EATENSTLESLSGKKLTQKLKEDSEAESTESVPLVCKSASAHNLSSEKKPGHPRTSMLQK
SLSVIASAKEKTLGLAGKTQTAGVEERTKSQKPLPKDKETKRNHSNSDNTETKDPAPQNS
NPAEEPRKPQKSGIMKQQRVNPTTANSDLNPGATQMKDNFDIGEVCPWEVYDLTPGPVPS
ESKVQKHVSIVASEMEKNPTFSLKEKSHHKPKAAEVCQQSNQKRIDKAEVCLWESQGQSI
LEDEKLLISKIPVLPERAKEENGGQPHAANVCAGQSEELPPKAVASKTENENLNQIGHQE
KKTSSSEENVRGSYNSSNNFQQPLTSRAEVCPWEFQTPAQPNAGRSVALPASSALSANKI
AGPRKEEVWDTFKV
Download sequence
Identical sequences G1S4A7
ENSNLEP00000020345 ENSNLEP00000020345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]