SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020370 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020370
Domain Number 1 Region: 3-129
Classification Level Classification E-value
Superfamily Lipocalins 5.56e-25
Family Retinol binding protein-like 0.0057
Further Details:      
 
Domain Number 2 Region: 165-224
Classification Level Classification E-value
Superfamily BPTI-like 1.56e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0001
Further Details:      
 
Domain Number 3 Region: 227-279
Classification Level Classification E-value
Superfamily BPTI-like 4.4e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020370   Gene: ENSNLEG00000016776   Transcript: ENSNLET00000021386
Sequence length 292
Comment pep:known_by_projection supercontig:Nleu1.0:GL397294.1:7889953:7907386:-1 gene:ENSNLEG00000016776 transcript:ENSNLET00000021386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRMTVSTLVLREGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITME
SYVVHTNYDEYAIFLTKKFSRRHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSI
FIMADRGECVPGEQEPEPILIPRVRRAVLPQEEEGSGGGQLVTEVTKKEDSCQLGYSAGP
CMGMTSRYFYNGTSMACETFQYGGCMGNGNNFITEKECLQTCRTVAACNLPMVRGPCQAF
IQLWAFDAVKGKCVLFTYGGCQGNGNKFYSEKECREYCGVPGDGDEELLRFN
Download sequence
Identical sequences ENSNLEP00000020370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]