SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020386 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000020386
Domain Number - Region: 155-254
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0259
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number - Region: 31-208
Classification Level Classification E-value
Superfamily Tropomyosin 0.0981
Family Tropomyosin 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020386   Gene: ENSNLEG00000016779   Transcript: ENSNLET00000021403
Sequence length 532
Comment pep:known_by_projection supercontig:Nleu1.0:GL397274.1:16990915:17157558:-1 gene:ENSNLEG00000016779 transcript:ENSNLET00000021403 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVVVIIIIIIIIIIIIIARAAAWDSAYLVCKRKLESKKEALLILSKELDTCQQERDQYK
LMANQLRERHQSLKKKYRELIDGDPSLPPEKRKQANLAQLLRDSQDRNKHLGEEIKELQQ
RLGEVQGDNKLLRMTIAKQRLGDEEIGVRHFAAHEREDLVQQLERAKEQIESLEHDLQAS
VDELQDVKEERSSYQDKVERLNQELNHILSGHENRIIDVDALCMENYLQERLKQLHEEVN
LLKSNIAKYKNALERRKNSKGQGKSSSSALTGVLSAKQVQDLLSEDHGCSLPATPQSISD
LKSLATALLETIHEKNMVIQHQRQTNKILGNRVAELEKKLRTLEVSGLWSLPGGKDTILF
SDPTLPSGQRSRSPLLKFVEQPTENKADPKDGEAQKQEGDESCAAAEVLTAPEDAGRPAV
NSPANQSRGNQCKLFHPSLPQLPSEEEVTALKGIIKLTEHAAAELEEVRRESPMEGQRSE
TGPTPPGLAIQGELPKSHLDSFEASQTAAEASTPEDGKGIPEGRGTRSTVKT
Download sequence
Identical sequences ENSNLEP00000020386 ENSNLEP00000020386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]