SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020551 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020551
Domain Number 1 Region: 368-645
Classification Level Classification E-value
Superfamily NHL repeat 1.7e-29
Family NHL repeat 0.0024
Further Details:      
 
Domain Number 2 Region: 14-76
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000236
Family RING finger domain, C3HC4 0.0074
Further Details:      
 
Domain Number 3 Region: 96-157
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000065
Family B-box zinc-binding domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020551   Gene: ENSNLEG00000016923   Transcript: ENSNLET00000021574
Sequence length 653
Comment pep:known_by_projection supercontig:Nleu1.0:GL397294.1:10550259:10564476:1 gene:ENSNLEG00000016923 transcript:ENSNLET00000021574 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAASHLNLDALREVLECPICMESFTEEQLRPKLLHCGHTICRQCLEKLLASSINGVR
CPFCSKITRITSLTQLTDNLTVLKIIDTAGLSEAVGLLMCRSCGRRLPRQFCRSCGLVLC
EPCREADHQPPGHCTLPVKEAAEERRRDFGEKLTRLRELMGELQRRKAALEGVSKDLQAR
YKAVLQEYGHEERRVQDELARSRKFFTGSLAEVEKSNSQVVEEQSYLLNIAEVQAVSRCD
YFLAKIKQADVALLEETADEEEPELTASLPRELTLQDVELLKVGHVGPLQIGQAVKKPRT
VNMEDSWAMEAAASAASTSVTFREMDMSPEEVVASPRASPAKQRGPEAASNIQQCLFLKK
MGAKGSTPGMFNLPVSLYVTSQGEVLVADRGNYRIQVFTRKGFLKEIRRSPSGIDSFVLS
FLGADLPNLTPLSVAMNCQGLIGVTDSYDNSLKVYTLDGHCVACHRSQLSKPWGITALPS
GQFVVTDVEGGKLWCFTVDRGSGVVKYTCLCSAVRPKFVTCDAEGTVYFTQGLGLNLENR
QNEHHLEGGFSIGSVGPDGQLGRQISHFFSENEDFRCIAGMCVDARGDLIVADSSRKEIL
HFPKGGGYSVLIREGLTCPVGIALTPKGQLLVLDCWDHCIKIYSYHLRRYSTP
Download sequence
Identical sequences A0A2I3GW37
ENSNLEP00000020551 XP_003264102.1.23891 XP_003264103.1.23891 XP_004088856.1.23891 XP_004088857.1.23891 XP_012364426.1.23891 XP_012364427.1.23891 ENSNLEP00000020551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]